Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2044
Gene name	EPH receptor A5
Gene symbol	EPHA5
Synonyms (NCBI Gene)	CEK7EHK-1EHK1EK7HEK7TYRO4
Chromosome	4
Chromosome location	4q13.1-q13.2
Summary	This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057520012	C>T	Likely-pathogenic	Coding sequence variant, missense variant

198

Show/Hide all (198)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006576	hsa-miR-34a-5p	Luciferase reporter assayWestern blot	22079638
MIRT025144	hsa-miR-181a-5p	Microarray	17612493
MIRT542992	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523890	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523889	hsa-miR-567	PAR-CLIP	21572407
MIRT523888	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT523887	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT523886	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523885	hsa-miR-297	PAR-CLIP	21572407
MIRT523884	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT523883	hsa-miR-147a	PAR-CLIP	21572407
MIRT523882	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT523881	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523880	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT542992	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523890	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523889	hsa-miR-567	PAR-CLIP	21572407
MIRT523888	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT523887	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT523886	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523885	hsa-miR-297	PAR-CLIP	21572407
MIRT523884	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT523883	hsa-miR-147a	PAR-CLIP	21572407
MIRT523882	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT523881	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523880	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT542992	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523890	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523889	hsa-miR-567	PAR-CLIP	21572407
MIRT523888	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT523887	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT523886	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523885	hsa-miR-297	PAR-CLIP	21572407
MIRT523884	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT523883	hsa-miR-147a	PAR-CLIP	21572407
MIRT523882	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT523881	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523880	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT523890	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT523889	hsa-miR-567	PAR-CLIP	23446348
MIRT523888	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT523887	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT523886	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523885	hsa-miR-297	PAR-CLIP	23446348
MIRT523884	hsa-miR-6818-5p	PAR-CLIP	23446348
MIRT523883	hsa-miR-147a	PAR-CLIP	23446348
MIRT523882	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT523881	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523880	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT542992	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523890	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523889	hsa-miR-567	PAR-CLIP	21572407
MIRT523888	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT523887	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT523886	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523885	hsa-miR-297	PAR-CLIP	21572407
MIRT523884	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT523883	hsa-miR-147a	PAR-CLIP	21572407
MIRT523882	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT523881	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523880	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT542992	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523890	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523889	hsa-miR-567	PAR-CLIP	21572407
MIRT523888	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT523887	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT523886	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523885	hsa-miR-297	PAR-CLIP	21572407
MIRT523884	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT523883	hsa-miR-147a	PAR-CLIP	21572407
MIRT523882	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT523881	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523880	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT542992	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523890	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523889	hsa-miR-567	PAR-CLIP	21572407
MIRT523888	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT523887	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT523886	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT523885	hsa-miR-297	PAR-CLIP	21572407
MIRT523884	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT523883	hsa-miR-147a	PAR-CLIP	21572407
MIRT523882	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT523881	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523880	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT523890	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT523889	hsa-miR-567	PAR-CLIP	23446348
MIRT523888	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT523887	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT523886	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523885	hsa-miR-297	PAR-CLIP	23446348
MIRT523884	hsa-miR-6818-5p	PAR-CLIP	23446348
MIRT523883	hsa-miR-147a	PAR-CLIP	23446348
MIRT523882	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT523881	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523880	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT966547	hsa-miR-137	CLIP-seq
MIRT966548	hsa-miR-147	CLIP-seq
MIRT966549	hsa-miR-193a-3p	CLIP-seq
MIRT966550	hsa-miR-193b	CLIP-seq
MIRT966551	hsa-miR-200b	CLIP-seq
MIRT966552	hsa-miR-200c	CLIP-seq
MIRT966553	hsa-miR-3128	CLIP-seq
MIRT966554	hsa-miR-338-5p	CLIP-seq
MIRT966555	hsa-miR-4275	CLIP-seq
MIRT966556	hsa-miR-429	CLIP-seq
MIRT966557	hsa-miR-4729	CLIP-seq
MIRT966558	hsa-miR-548ag	CLIP-seq
MIRT966559	hsa-miR-548ai	CLIP-seq
MIRT966560	hsa-miR-556-5p	CLIP-seq
MIRT966561	hsa-miR-599	CLIP-seq
MIRT966562	hsa-miR-892b	CLIP-seq
MIRT966563	hsa-miR-106a	CLIP-seq
MIRT966564	hsa-miR-106b	CLIP-seq
MIRT966565	hsa-miR-1299	CLIP-seq
MIRT966566	hsa-miR-146a	CLIP-seq
MIRT966567	hsa-miR-146b-5p	CLIP-seq
MIRT966548	hsa-miR-147	CLIP-seq
MIRT966568	hsa-miR-17	CLIP-seq
MIRT966569	hsa-miR-20a	CLIP-seq
MIRT966570	hsa-miR-20b	CLIP-seq
MIRT966571	hsa-miR-218	CLIP-seq
MIRT966572	hsa-miR-23a	CLIP-seq
MIRT966573	hsa-miR-23b	CLIP-seq
MIRT966574	hsa-miR-23c	CLIP-seq
MIRT966575	hsa-miR-302a	CLIP-seq
MIRT966576	hsa-miR-302b	CLIP-seq
MIRT966577	hsa-miR-302c	CLIP-seq
MIRT966578	hsa-miR-302d	CLIP-seq
MIRT966579	hsa-miR-302e	CLIP-seq
MIRT966580	hsa-miR-3163	CLIP-seq
MIRT966581	hsa-miR-326	CLIP-seq
MIRT966582	hsa-miR-330-5p	CLIP-seq
MIRT966583	hsa-miR-372	CLIP-seq
MIRT966584	hsa-miR-373	CLIP-seq
MIRT966585	hsa-miR-410	CLIP-seq
MIRT966586	hsa-miR-4251	CLIP-seq
MIRT966587	hsa-miR-4303	CLIP-seq
MIRT966588	hsa-miR-4329	CLIP-seq
MIRT966589	hsa-miR-4796-5p	CLIP-seq
MIRT966590	hsa-miR-519d	CLIP-seq
MIRT966591	hsa-miR-520a-3p	CLIP-seq
MIRT966592	hsa-miR-520b	CLIP-seq
MIRT966593	hsa-miR-520c-3p	CLIP-seq
MIRT966594	hsa-miR-520d-3p	CLIP-seq
MIRT966595	hsa-miR-520e	CLIP-seq
MIRT966596	hsa-miR-548n	CLIP-seq
MIRT966597	hsa-miR-548t	CLIP-seq
MIRT966598	hsa-miR-589	CLIP-seq
MIRT966599	hsa-miR-590-3p	CLIP-seq
MIRT966561	hsa-miR-599	CLIP-seq
MIRT966600	hsa-miR-636	CLIP-seq
MIRT966601	hsa-miR-654-3p	CLIP-seq
MIRT966602	hsa-miR-875-3p	CLIP-seq
MIRT966603	hsa-miR-93	CLIP-seq
MIRT966604	hsa-miR-944	CLIP-seq
MIRT966557	hsa-miR-4729	CLIP-seq
MIRT966557	hsa-miR-4729	CLIP-seq
MIRT966557	hsa-miR-4729	CLIP-seq
MIRT1986283	hsa-miR-204	CLIP-seq
MIRT1986284	hsa-miR-211	CLIP-seq
MIRT1986285	hsa-miR-3646	CLIP-seq
MIRT1986286	hsa-miR-3662	CLIP-seq
MIRT1986287	hsa-miR-4282	CLIP-seq
MIRT1986288	hsa-miR-548a-3p	CLIP-seq
MIRT1986289	hsa-miR-548e	CLIP-seq
MIRT1986290	hsa-miR-548f	CLIP-seq
MIRT966560	hsa-miR-556-5p	CLIP-seq
MIRT1986291	hsa-miR-562	CLIP-seq
MIRT2220865	hsa-miR-1254	CLIP-seq
MIRT2220866	hsa-miR-1290	CLIP-seq
MIRT2220867	hsa-miR-142-5p	CLIP-seq
MIRT2220868	hsa-miR-3116	CLIP-seq
MIRT2220869	hsa-miR-3167	CLIP-seq
MIRT2220870	hsa-miR-4427	CLIP-seq
MIRT2220871	hsa-miR-4698	CLIP-seq
MIRT966557	hsa-miR-4729	CLIP-seq
MIRT2220872	hsa-miR-4789-5p	CLIP-seq
MIRT2220873	hsa-miR-661	CLIP-seq
MIRT2220874	hsa-miR-876-5p	CLIP-seq
MIRT966604	hsa-miR-944	CLIP-seq
MIRT966548	hsa-miR-147	CLIP-seq
MIRT966548	hsa-miR-147	CLIP-seq
MIRT2465230	hsa-miR-3138	CLIP-seq
MIRT2465231	hsa-miR-3911	CLIP-seq
MIRT2465232	hsa-miR-4800-5p	CLIP-seq
MIRT966561	hsa-miR-599	CLIP-seq
MIRT2465233	hsa-miR-644	CLIP-seq
MIRT2465234	hsa-miR-711	CLIP-seq
MIRT966580	hsa-miR-3163	CLIP-seq
MIRT2524579	hsa-miR-4760-5p	CLIP-seq
MIRT2524580	hsa-miR-577	CLIP-seq
MIRT966555	hsa-miR-4275	CLIP-seq
MIRT1986288	hsa-miR-548a-3p	CLIP-seq
MIRT2680192	hsa-miR-548c-3p	CLIP-seq
MIRT1986289	hsa-miR-548e	CLIP-seq
MIRT1986290	hsa-miR-548f	CLIP-seq
MIRT2680193	hsa-miR-885-5p	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005003	Function	Ephrin receptor activity	ISS
GO:0005004	Function	GPI-linked ephrin receptor activity	ISS
GO:0005005	Function	Transmembrane-ephrin receptor activity	IBA
GO:0005005	Function	Transmembrane-ephrin receptor activity	NAS	7898931
GO:0005515	Function	Protein binding	IPI	35384245
GO:0005524	Function	ATP binding	IEA
GO:0005791	Component	Rough endoplasmic reticulum	IDA	10375373
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10375373
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	ISS
GO:0009897	Component	External side of plasma membrane	IDA	10064801
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021766	Process	Hippocampus development	ISS
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IDA	9191074, 10375373
GO:0030425	Component	Dendrite	IEA
GO:0032793	Process	Positive regulation of CREB transcription factor activity	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IDA	10375373
GO:0043087	Process	Regulation of GTPase activity	ISS
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10375373
GO:0048666	Process	Neuron development	IEP	10375373
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	ISS

MIM	HGNC	e!Ensembl
600004	3389	ENSG00000145242

P54756

Protein name

Ephrin type-A receptor 5 (EC 2.7.10.1) (Brain-specific kinase) (EPH homology kinase 1) (EHK-1) (EPH-like kinase 7) (EK7) (hEK7)

Protein function

Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is

PDB

2R2P , 4ET7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01404	Ephrin_lbd	61 → 233	Ephrin receptor ligand binding domain	Domain
PF00041	fn3	359 → 453	Fibronectin type III domain	Domain
PF00041	fn3	470 → 552	Fibronectin type III domain	Domain
PF14575	EphA2_TM	574 → 672	Ephrin type-A receptor 2 transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	675 → 932	Protein tyrosine and serine/threonine kinase	Domain
PF00536	SAM_1	964 → 1027	SAM domain (Sterile alpha motif)	Domain

Tissue specificity

TISSUE SPECIFICITY: Almost exclusively expressed in the nervous system in cortical neurons, cerebellar Purkinje cells and pyramidal neurons within the cortex and hippocampus. Display an increasing gradient of expression from the forebrain to hindbrain and

Sequence

MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE
VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN
EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD
ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL
AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA
PRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKI
AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI
RARTAAGYGVFSRRFEFETTPVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCE
CGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPN
QAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRD
FLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGM
LRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSP
MDCPAALYQLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHS
PLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIM
NSLQEMKVQLVNGMVPL

Sequence length

1037

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		EPH-Ephrin signaling EPHA-mediated growth cone collapse EPH-ephrin mediated repulsion of cells

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOBAL DEVELOPMENTAL DELAY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (65)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	16140923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31181069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	31181069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31181069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	21804549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	34109382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23824631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30724859		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29805590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	32251017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19733895, 23496902, 25036402, 27651378, 30620624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23496902, 33977106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25609195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25609195, 27887627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27651378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26909918, 27887627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28421649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34331411	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27651378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36745477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	29330744, 29762250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28421649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	12422604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31181069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31181069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	23485646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19176381, 9191074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	31023863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	33210795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	25609195	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	23485646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29356025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	39925800	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19733895, 23496902, 25036402, 27651378, 30620624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27651378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25609195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29805590, 30620624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19733895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35181301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31181069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19176381, 19733895, 22952847, 27651378, 28421649, 30620624, 31186729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	27582484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	23776197, 27582484		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27887627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27887627, 36345952, 39925800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	27887627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19949912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	22843789, 31823378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30724859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25609195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25609195	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35860812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensory neuropathy	Sensory neuropathy	BEFREE	22843789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31186729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26769141, 36164608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EPHA5 (EPH receptor A5)