Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	203328
Gene name	Sushi domain containing 3
Gene symbol	SUSD3
Synonyms (NCBI Gene)	-
Chromosome	9
Chromosome location	9q22.31

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017039	hsa-miR-335-5p	Microarray	18185580
MIRT1404047	hsa-miR-1297	CLIP-seq
MIRT1404048	hsa-miR-140-5p	CLIP-seq
MIRT1404049	hsa-miR-199a-3p	CLIP-seq
MIRT1404050	hsa-miR-199b-3p	CLIP-seq
MIRT1404051	hsa-miR-26a	CLIP-seq
MIRT1404052	hsa-miR-26b	CLIP-seq
MIRT1404053	hsa-miR-3129-5p	CLIP-seq
MIRT1404054	hsa-miR-3163	CLIP-seq
MIRT1404055	hsa-miR-3201	CLIP-seq
MIRT1404056	hsa-miR-3545-5p	CLIP-seq
MIRT1404057	hsa-miR-4460	CLIP-seq
MIRT1404058	hsa-miR-4465	CLIP-seq
MIRT1404059	hsa-miR-4791	CLIP-seq
MIRT1404060	hsa-miR-4797-3p	CLIP-seq
MIRT1404061	hsa-miR-498	CLIP-seq
MIRT1404062	hsa-miR-548c-3p	CLIP-seq
MIRT1404063	hsa-miR-936	CLIP-seq
MIRT2121209	hsa-miR-28-3p	CLIP-seq
MIRT2121210	hsa-miR-4720-3p	CLIP-seq
MIRT2121211	hsa-miR-4804-3p	CLIP-seq
MIRT2343126	hsa-miR-138	CLIP-seq
MIRT2343127	hsa-miR-199a-5p	CLIP-seq
MIRT2343128	hsa-miR-199b-5p	CLIP-seq
MIRT2343129	hsa-miR-3064-5p	CLIP-seq
MIRT2343130	hsa-miR-3176	CLIP-seq
MIRT2343131	hsa-miR-3178	CLIP-seq
MIRT1404055	hsa-miR-3201	CLIP-seq
MIRT2343132	hsa-miR-3652	CLIP-seq
MIRT2343133	hsa-miR-3911	CLIP-seq
MIRT2343134	hsa-miR-3922-3p	CLIP-seq
MIRT2343135	hsa-miR-4286	CLIP-seq
MIRT2343136	hsa-miR-4302	CLIP-seq
MIRT2343137	hsa-miR-4430	CLIP-seq
MIRT2343138	hsa-miR-4456	CLIP-seq
MIRT2343139	hsa-miR-4486	CLIP-seq
MIRT2343140	hsa-miR-4487	CLIP-seq
MIRT2343141	hsa-miR-4491	CLIP-seq
MIRT2343142	hsa-miR-4505	CLIP-seq
MIRT2343143	hsa-miR-4657	CLIP-seq
MIRT2343144	hsa-miR-4757-5p	CLIP-seq
MIRT2343145	hsa-miR-4764-5p	CLIP-seq
MIRT1404059	hsa-miR-4791	CLIP-seq
MIRT2343146	hsa-miR-516a-5p	CLIP-seq
MIRT2343147	hsa-miR-541	CLIP-seq
MIRT2343148	hsa-miR-615-5p	CLIP-seq
MIRT2343149	hsa-miR-622	CLIP-seq
MIRT2343150	hsa-miR-654-5p	CLIP-seq
MIRT2343151	hsa-miR-892b	CLIP-seq
MIRT2343126	hsa-miR-138	CLIP-seq
MIRT2343129	hsa-miR-3064-5p	CLIP-seq
MIRT2343132	hsa-miR-3652	CLIP-seq
MIRT2343137	hsa-miR-4430	CLIP-seq
MIRT2343138	hsa-miR-4456	CLIP-seq
MIRT2343141	hsa-miR-4491	CLIP-seq
MIRT2343142	hsa-miR-4505	CLIP-seq
MIRT2637010	hsa-miR-4653-3p	CLIP-seq
MIRT2343143	hsa-miR-4657	CLIP-seq
MIRT2343147	hsa-miR-541	CLIP-seq
MIRT2343150	hsa-miR-654-5p	CLIP-seq
MIRT2343151	hsa-miR-892b	CLIP-seq
MIRT2343126	hsa-miR-138	CLIP-seq
MIRT2343129	hsa-miR-3064-5p	CLIP-seq
MIRT2343132	hsa-miR-3652	CLIP-seq
MIRT2343137	hsa-miR-4430	CLIP-seq
MIRT2343138	hsa-miR-4456	CLIP-seq
MIRT2343141	hsa-miR-4491	CLIP-seq
MIRT2343142	hsa-miR-4505	CLIP-seq
MIRT2637010	hsa-miR-4653-3p	CLIP-seq
MIRT2343143	hsa-miR-4657	CLIP-seq
MIRT2343147	hsa-miR-541	CLIP-seq
MIRT2343150	hsa-miR-654-5p	CLIP-seq
MIRT2343151	hsa-miR-892b	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24413080
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
616429	28391	ENSG00000157303

Q96L08

Protein name

Sushi domain-containing protein 3

Protein function

May play a role in breast tumorigenesis by promoting estrogen-dependent cell proliferation, cell-cell interactions and migration.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00084	Sushi	32 → 91	Sushi repeat (SCR repeat)	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in estrogen receptor-positive breast tumors. {ECO:0000269|PubMed:24413080}.

Sequence

MRWAAATLRGKARPRGRAGVTTPAPGNRTGTCAKLRLPPQATFQVLRGNGASVGTVLMFR
CPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVAVIASIVSCAIILLMS
MAFLTCCLLKCVKKSKRRRSNRSAQLWSQLKDEDLETVQAAYLGLKHFNKPVSGPSQAHD
NHSFTTDHGESTSKLASVTRSVDKDPGIPRALSLSGSSSSPQAQVMVHMANPRQPLPASG
LATGMPQQPAAYALG

Sequence length

255

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial fibrillation	Pubtator	37203300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24413080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24413080, 26745129, 40191190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29138345	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	37203300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24413080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24413080		★★★★★ ★☆☆☆☆ Found in Text Mining only

SUSD3 (sushi domain containing 3)