Gene Gene information from NCBI Gene database.
Entrez ID 203245
Gene name Nuclear apoptosis inducing factor 1
Gene symbol NAIF1
Synonyms (NCBI Gene)
C9orf90bA379C10.2
Chromosome 9
Chromosome location 9q34.11
miRNA miRNA information provided by mirtarbase database.
323
miRTarBase ID miRNA Experiments Reference
MIRT692694 hsa-miR-4640-3p HITS-CLIP 23313552
MIRT692693 hsa-miR-6834-3p HITS-CLIP 23313552
MIRT692692 hsa-miR-4717-3p HITS-CLIP 23313552
MIRT692691 hsa-miR-6884-3p HITS-CLIP 23313552
MIRT692690 hsa-miR-6801-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21044950, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 16378748
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610673 25446 ENSG00000171169
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q69YI7
Protein name Nuclear apoptosis-inducing factor 1
Protein function Induces apoptosis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13873 Myb_DNA-bind_5 8 85 Myb/SANT-like DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16378748}.
Sequence
MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHGILRRVNAVAT
CRRELPEVKKKWSDLKTEVRRKVAQ
VRAAVEGGEAPGPTEEDGAGGPGTGGGSGGGGPAV
APVLLTPMQQRICNLLGEATIISLPSTTEIHPVALGPSATAAAATVTLTQIPTETTYHTL
EEGVVEYCTAEAPPPLPPETPVDMMAQHADTSVKPQALKSRIALNSAKLIQEQRVTNLHV
KEIAQHLEQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYL
QSNTANPAPASDPGQVAQNGQPDSIIQ
Sequence length 327
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinogenesis Carcinogenesis Pubtator 30407643 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 30407643
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 25725584
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 25725584
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 21286669, 24926661
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 21286669, 24926661
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma BEFREE 25725584
★☆☆☆☆
Found in Text Mining only
Osteosarcoma Osteosarcoma BEFREE 30407643
★☆☆☆☆
Found in Text Mining only
Osteosarcoma Osteosarcoma Pubtator 30407643 Inhibit
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease Pubtator 34607512 Associate
★☆☆☆☆
Found in Text Mining only