ENPEP (glutamyl aminopeptidase)

Gene

• Entrez ID: 2028
• Gene name: Glutamyl aminopeptidase
• Gene symbol: ENPEP
• Synonyms (NCBI Gene): APA, CD249, gp160
• Chromosome: 4
• Chromosome location: 4q25
• Summary: The ENPEP gene encodes glutamyl aminopeptidase, a type II integral membrane protein with an extracellular zinc-binding domain. This protein can upregulate blood pressure by cleaving the N-terminal aspartate from angiotensin II, and can regulate blood vess

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044621	hsa-miR-320a	CLASH	23622248
MIRT437377	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	24098452
MIRT437377	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	24098452
MIRT963886	hsa-miR-129-5p	CLIP-seq
MIRT963887	hsa-miR-1297	CLIP-seq
MIRT963888	hsa-miR-1299	CLIP-seq
MIRT963889	hsa-miR-133a	CLIP-seq
MIRT963890	hsa-miR-133b	CLIP-seq
MIRT963891	hsa-miR-141	CLIP-seq
MIRT963892	hsa-miR-200a	CLIP-seq
MIRT963893	hsa-miR-2110	CLIP-seq
MIRT963894	hsa-miR-26a	CLIP-seq
MIRT963895	hsa-miR-26b	CLIP-seq
MIRT963896	hsa-miR-3150a-3p	CLIP-seq
MIRT963897	hsa-miR-3159	CLIP-seq
MIRT963898	hsa-miR-4271	CLIP-seq
MIRT963899	hsa-miR-4418	CLIP-seq
MIRT963900	hsa-miR-4465	CLIP-seq
MIRT963901	hsa-miR-4527	CLIP-seq
MIRT963902	hsa-miR-4725-3p	CLIP-seq
MIRT963903	hsa-miR-4726-3p	CLIP-seq
MIRT963904	hsa-miR-4760-3p	CLIP-seq
MIRT963905	hsa-miR-509-3-5p	CLIP-seq
MIRT963906	hsa-miR-509-5p	CLIP-seq
MIRT963907	hsa-miR-513a-3p	CLIP-seq
MIRT963908	hsa-miR-548a-3p	CLIP-seq
MIRT963909	hsa-miR-548e	CLIP-seq
MIRT963910	hsa-miR-548f	CLIP-seq
MIRT963911	hsa-miR-875-3p	CLIP-seq
MIRT963912	hsa-miR-9	CLIP-seq
MIRT1548343	hsa-miR-132	CLIP-seq
MIRT1548344	hsa-miR-212	CLIP-seq
MIRT1548345	hsa-miR-3157-5p	CLIP-seq
MIRT1548346	hsa-miR-4691-3p	CLIP-seq
MIRT1548347	hsa-miR-4709-5p	CLIP-seq
MIRT1985692	hsa-miR-105	CLIP-seq
MIRT1985693	hsa-miR-1295	CLIP-seq
MIRT1985694	hsa-miR-27a	CLIP-seq
MIRT1985695	hsa-miR-27b	CLIP-seq
MIRT1985696	hsa-miR-3150b-3p	CLIP-seq
MIRT1985697	hsa-miR-3658	CLIP-seq
MIRT1985698	hsa-miR-3977	CLIP-seq
MIRT1985699	hsa-miR-4257	CLIP-seq
MIRT1985700	hsa-miR-4662a-3p	CLIP-seq
MIRT1985701	hsa-miR-4717-5p	CLIP-seq
MIRT1985702	hsa-miR-4784	CLIP-seq
MIRT1985703	hsa-miR-513a-5p	CLIP-seq
MIRT1985704	hsa-miR-520d-5p	CLIP-seq
MIRT1985705	hsa-miR-524-5p	CLIP-seq
MIRT2220116	hsa-miR-1200	CLIP-seq
MIRT1985694	hsa-miR-27a	CLIP-seq
MIRT1985695	hsa-miR-27b	CLIP-seq
MIRT2220117	hsa-miR-3074-5p	CLIP-seq
MIRT2220118	hsa-miR-3124-3p	CLIP-seq
MIRT2220119	hsa-miR-3140-5p	CLIP-seq
MIRT2220120	hsa-miR-4753-3p	CLIP-seq
MIRT2220121	hsa-miR-4768-5p	CLIP-seq
MIRT1985703	hsa-miR-513a-5p	CLIP-seq
MIRT2220122	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0002003	Process	Angiotensin maturation	IBA
GO:0002003	Process	Angiotensin maturation	IEA
GO:0002003	Process	Angiotensin maturation	NAS	19608358
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IDA	19608358
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	NAS	8346219
GO:0004177	Function	Aminopeptidase activity	IDA	8244382, 10692253
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004230	Function	Glutamyl aminopeptidase activity	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10692253
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	8244382
GO:0005886	Component	Plasma membrane	TAS
GO:0005903	Component	Brush border	IEA
GO:0005903	Component	Brush border	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0007267	Process	Cell-cell signaling	NAS	8346219
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IDA	14998491
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009897	Component	External side of plasma membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016477	Process	Cell migration	IDA	14998491
GO:0016787	Function	Hydrolase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0032835	Process	Glomerulus development	IEA
GO:0032835	Process	Glomerulus development	ISS
GO:0043171	Process	Peptide catabolic process	IBA
GO:0045177	Component	Apical part of cell	IEA
GO:0045177	Component	Apical part of cell	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IBA
GO:0070006	Function	Metalloaminopeptidase activity	IDA	8346219, 23888046
GO:0070006	Function	Metalloaminopeptidase activity	NAS	8244382
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 138297
• HGNC: 3355
• e!Ensembl: ENSG00000138792

Protein

• UniProt ID: Q07075
• Protein name: Glutamyl aminopeptidase (EAP) (EC 3.4.11.7) (Aminopeptidase A) (AP-A) (Differentiation antigen gp160) (CD antigen CD249)
• Protein function: Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II.
• PDB: 4KX7, 4KX8, 4KX9, 4KXA, 4KXB, 4KXC, 4KXD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17900	Peptidase_M1_N	98 → 286		Domain
  PF01433	Peptidase_M1	321 → 538	Peptidase family M1 domain	Domain
  PF11838	ERAP1_C	616 → 934	ERAP1-like C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in choriocarcinoma cancer cell lines (at protein level) (PubMed:10692253). Expressed by epithelial cells of the proximal tubule cells and the glomerulus of the nephron. Also found in a variety of other tissues. {ECO:0000269|P
• Sequence:

  MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL
  PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS
  ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS
  SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK
  ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
  SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME
  NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS
  FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS
  KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR
  QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
  KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID
  DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF
  QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV
  NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK
  DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
  TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG

• Sequence length: 957

Pathways

KEGG:

Renin-angiotensin system

Reactome:

Metabolism of Angiotensinogen to Angiotensins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	31124944		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11380493, 24242700, 24758183, 9140790		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	24242700, 28332880		★☆☆☆☆ Found in Text Mining only
AL-RAQAD SYNDROME	AL-Raqad Syndrome	BEFREE	29100920		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30873069		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30873069		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31751311		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36012391	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30370863		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	25888893		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	8171026		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	29369662		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24098452, 31100099		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24098452, 36936167	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34862755	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16985214, 24885240, 8346219, 9486416	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18216146, 28809959	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30949864, 31296113		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	15048132		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15048132		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11718570		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	18216146		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28177885		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34285715	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37359548	Associate	★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	12361682		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30531435, 30599150		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	1352575, 24242700, 28332880, 28332881, 30462153		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	23443813, 24242700, 28332881, 30462153		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28809959		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29156994		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28468961, 30274071		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28468961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysphoric mood	Mood Disorder	BEFREE	30474244		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36412985	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	30462153		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	18206321		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24814343		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24814343		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28202497		★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	28332881		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30531435, 30599150		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24098452	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18550936, 37451613	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Renal	Renal hypertension	Pubtator	18206321	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18550936, 18726831, 28968260, 31067198, 31115779, 31495277, 31786978, 9140790		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18550936		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	30487518		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	12396109, 22243136		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18206321	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	24885240, 28809959		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	18216146, 24885240, 28809959	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23794217, 28541649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23794217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	24098452, 31100099		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18677709		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27075335, 28177885, 28332880, 29106591		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24098452		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28411193		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28956950, 29369662, 30873069		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11739707	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	7533526, 8171026, 8395054		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	7533526, 8171026, 8395054		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	8171026		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30531435, 30599150		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18216146, 23443813, 24098452, 28399178, 28809959, 8577711, 9140790		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28837728		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28411193		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30483154, 31197649		★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	18216146		★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	29306067		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37006267	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28821411, 29793839		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	31751311		★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	30053011		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33481347	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30847776		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29550742		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18677709		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36012391	Stimulate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8346219		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	28202497		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28399178, 30531435		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15048132		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	23794217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations