Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2026
Gene name	Enolase 2
Gene symbol	ENO2
Synonyms (NCBI Gene)	HEL-S-279NSE
Chromosome	12
Chromosome location	12p13.31
Summary	This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats a

286

Show/Hide all (286)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044208	hsa-miR-99b-5p	CLASH	23622248
MIRT038722	hsa-miR-93-3p	CLASH	23622248
MIRT440723	hsa-miR-382-3p	HITS-CLIP	24374217
MIRT440723	hsa-miR-382-3p	HITS-CLIP	24374217
MIRT732552	hsa-miR-301a-3p	RNA-seq	33037409
MIRT732553	hsa-miR-375	RNA-seq	33037409
MIRT963610	hsa-miR-1266	CLIP-seq
MIRT963611	hsa-miR-139-5p	CLIP-seq
MIRT963612	hsa-miR-24	CLIP-seq
MIRT963613	hsa-miR-3664-3p	CLIP-seq
MIRT963614	hsa-miR-4283	CLIP-seq
MIRT963615	hsa-miR-4437	CLIP-seq
MIRT963616	hsa-miR-4489	CLIP-seq
MIRT963617	hsa-miR-4518	CLIP-seq
MIRT963618	hsa-miR-4640-3p	CLIP-seq
MIRT963619	hsa-miR-4691-3p	CLIP-seq
MIRT963620	hsa-miR-4695-3p	CLIP-seq
MIRT963621	hsa-miR-4728-3p	CLIP-seq
MIRT1985625	hsa-miR-1255a	CLIP-seq
MIRT1985626	hsa-miR-1255b	CLIP-seq
MIRT1985627	hsa-miR-1295	CLIP-seq
MIRT1985628	hsa-miR-1302	CLIP-seq
MIRT1985629	hsa-miR-3126-5p	CLIP-seq
MIRT1985630	hsa-miR-3190	CLIP-seq
MIRT1985631	hsa-miR-335	CLIP-seq
MIRT1985632	hsa-miR-3605-5p	CLIP-seq
MIRT1985633	hsa-miR-3679-3p	CLIP-seq
MIRT1985634	hsa-miR-4257	CLIP-seq
MIRT1985635	hsa-miR-4298	CLIP-seq
MIRT1985636	hsa-miR-4303	CLIP-seq
MIRT1985637	hsa-miR-4311	CLIP-seq
MIRT1985638	hsa-miR-4328	CLIP-seq
MIRT1985639	hsa-miR-4419a	CLIP-seq
MIRT1985640	hsa-miR-4424	CLIP-seq
MIRT1985641	hsa-miR-4459	CLIP-seq
MIRT1985642	hsa-miR-4510	CLIP-seq
MIRT1985643	hsa-miR-4648	CLIP-seq
MIRT1985644	hsa-miR-4649-3p	CLIP-seq
MIRT1985645	hsa-miR-4717-5p	CLIP-seq
MIRT1985646	hsa-miR-4762-3p	CLIP-seq
MIRT1985647	hsa-miR-4796-3p	CLIP-seq
MIRT1985648	hsa-miR-518a-5p	CLIP-seq
MIRT1985649	hsa-miR-520g	CLIP-seq
MIRT1985650	hsa-miR-520h	CLIP-seq
MIRT1985651	hsa-miR-527	CLIP-seq
MIRT1985652	hsa-miR-642b	CLIP-seq
MIRT1985653	hsa-miR-665	CLIP-seq
MIRT1985654	hsa-miR-7	CLIP-seq
MIRT2220080	hsa-miR-3120-3p	CLIP-seq
MIRT1985629	hsa-miR-3126-5p	CLIP-seq
MIRT1985634	hsa-miR-4257	CLIP-seq
MIRT2220081	hsa-miR-4270	CLIP-seq
MIRT1985636	hsa-miR-4303	CLIP-seq
MIRT1985639	hsa-miR-4419a	CLIP-seq
MIRT2220082	hsa-miR-4441	CLIP-seq
MIRT1985642	hsa-miR-4510	CLIP-seq
MIRT1985644	hsa-miR-4649-3p	CLIP-seq
MIRT2220083	hsa-miR-4705	CLIP-seq
MIRT1985646	hsa-miR-4762-3p	CLIP-seq
MIRT2220084	hsa-miR-501-3p	CLIP-seq
MIRT2220085	hsa-miR-502-3p	CLIP-seq
MIRT2220086	hsa-miR-503	CLIP-seq
MIRT2523859	hsa-miR-106a	CLIP-seq
MIRT2523860	hsa-miR-106b	CLIP-seq
MIRT2523861	hsa-miR-1207-3p	CLIP-seq
MIRT2523862	hsa-miR-1224-3p	CLIP-seq
MIRT2523863	hsa-miR-1260	CLIP-seq
MIRT2523864	hsa-miR-1260b	CLIP-seq
MIRT2523865	hsa-miR-1280	CLIP-seq
MIRT1985627	hsa-miR-1295	CLIP-seq
MIRT2523866	hsa-miR-1301	CLIP-seq
MIRT1985628	hsa-miR-1302	CLIP-seq
MIRT963611	hsa-miR-139-5p	CLIP-seq
MIRT2523867	hsa-miR-17	CLIP-seq
MIRT2523868	hsa-miR-185	CLIP-seq
MIRT2523869	hsa-miR-1972	CLIP-seq
MIRT2523870	hsa-miR-20a	CLIP-seq
MIRT2523871	hsa-miR-20b	CLIP-seq
MIRT2523872	hsa-miR-2110	CLIP-seq
MIRT2523873	hsa-miR-23a	CLIP-seq
MIRT2523874	hsa-miR-23b	CLIP-seq
MIRT2523875	hsa-miR-23c	CLIP-seq
MIRT2523876	hsa-miR-296-3p	CLIP-seq
MIRT2523877	hsa-miR-3064-3p	CLIP-seq
MIRT2523878	hsa-miR-3065-3p	CLIP-seq
MIRT2523879	hsa-miR-3115	CLIP-seq
MIRT2220080	hsa-miR-3120-3p	CLIP-seq
MIRT2523880	hsa-miR-3125	CLIP-seq
MIRT1985629	hsa-miR-3126-5p	CLIP-seq
MIRT2523881	hsa-miR-3135b	CLIP-seq
MIRT2523882	hsa-miR-3150a-3p	CLIP-seq
MIRT2523883	hsa-miR-3163	CLIP-seq
MIRT2523884	hsa-miR-3171	CLIP-seq
MIRT2523885	hsa-miR-3173-3p	CLIP-seq
MIRT2523886	hsa-miR-3175	CLIP-seq
MIRT2523887	hsa-miR-3183	CLIP-seq
MIRT2523888	hsa-miR-3185	CLIP-seq
MIRT1985630	hsa-miR-3190	CLIP-seq
MIRT2523889	hsa-miR-3194-3p	CLIP-seq
MIRT2523890	hsa-miR-330-3p	CLIP-seq
MIRT1985631	hsa-miR-335	CLIP-seq
MIRT2523891	hsa-miR-3591-3p	CLIP-seq
MIRT2523892	hsa-miR-361-3p	CLIP-seq
MIRT2523893	hsa-miR-3622b-5p	CLIP-seq
MIRT2523894	hsa-miR-3675-5p	CLIP-seq
MIRT1985633	hsa-miR-3679-3p	CLIP-seq
MIRT2523895	hsa-miR-3688-5p	CLIP-seq
MIRT2523896	hsa-miR-3691-3p	CLIP-seq
MIRT2523897	hsa-miR-369-3p	CLIP-seq
MIRT2523898	hsa-miR-374a	CLIP-seq
MIRT2523899	hsa-miR-374b	CLIP-seq
MIRT2523900	hsa-miR-3916	CLIP-seq
MIRT2523901	hsa-miR-3944-5p	CLIP-seq
MIRT2523902	hsa-miR-3976	CLIP-seq
MIRT2523903	hsa-miR-3978	CLIP-seq
MIRT1985634	hsa-miR-4257	CLIP-seq
MIRT2523904	hsa-miR-4271	CLIP-seq
MIRT2523905	hsa-miR-4281	CLIP-seq
MIRT1985635	hsa-miR-4298	CLIP-seq
MIRT2523906	hsa-miR-4299	CLIP-seq
MIRT1985636	hsa-miR-4303	CLIP-seq
MIRT2523907	hsa-miR-4306	CLIP-seq
MIRT1985637	hsa-miR-4311	CLIP-seq
MIRT2523908	hsa-miR-4318	CLIP-seq
MIRT1985638	hsa-miR-4328	CLIP-seq
MIRT1985639	hsa-miR-4419a	CLIP-seq
MIRT1985640	hsa-miR-4424	CLIP-seq
MIRT2523909	hsa-miR-4436b-3p	CLIP-seq
MIRT2523910	hsa-miR-4456	CLIP-seq
MIRT2523911	hsa-miR-4468	CLIP-seq
MIRT2523912	hsa-miR-4506	CLIP-seq
MIRT2523913	hsa-miR-450b-3p	CLIP-seq
MIRT1985642	hsa-miR-4510	CLIP-seq
MIRT2523914	hsa-miR-451b	CLIP-seq
MIRT963618	hsa-miR-4640-3p	CLIP-seq
MIRT2523915	hsa-miR-4643	CLIP-seq
MIRT2523916	hsa-miR-4644	CLIP-seq
MIRT1985643	hsa-miR-4648	CLIP-seq
MIRT1985644	hsa-miR-4649-3p	CLIP-seq
MIRT2523917	hsa-miR-4649-5p	CLIP-seq
MIRT2523918	hsa-miR-4650-5p	CLIP-seq
MIRT2523919	hsa-miR-4660	CLIP-seq
MIRT2523920	hsa-miR-4662a-5p	CLIP-seq
MIRT2523921	hsa-miR-4676-5p	CLIP-seq
MIRT963619	hsa-miR-4691-3p	CLIP-seq
MIRT2523922	hsa-miR-4696	CLIP-seq
MIRT2523923	hsa-miR-4704-5p	CLIP-seq
MIRT2523924	hsa-miR-4713-3p	CLIP-seq
MIRT2523925	hsa-miR-4717-3p	CLIP-seq
MIRT1985645	hsa-miR-4717-5p	CLIP-seq
MIRT2523926	hsa-miR-4723-3p	CLIP-seq
MIRT2523927	hsa-miR-4725-3p	CLIP-seq
MIRT2523928	hsa-miR-4725-5p	CLIP-seq
MIRT963621	hsa-miR-4728-3p	CLIP-seq
MIRT2523929	hsa-miR-4732-3p	CLIP-seq
MIRT2523930	hsa-miR-4755-3p	CLIP-seq
MIRT2523931	hsa-miR-4761-3p	CLIP-seq
MIRT1985646	hsa-miR-4762-3p	CLIP-seq
MIRT2523932	hsa-miR-4773	CLIP-seq
MIRT2523933	hsa-miR-4779	CLIP-seq
MIRT2523934	hsa-miR-4795-5p	CLIP-seq
MIRT2523935	hsa-miR-500a	CLIP-seq
MIRT2523936	hsa-miR-504	CLIP-seq
MIRT2523937	hsa-miR-5047	CLIP-seq
MIRT2523938	hsa-miR-519d	CLIP-seq
MIRT2523939	hsa-miR-532-3p	CLIP-seq
MIRT2523940	hsa-miR-548q	CLIP-seq
MIRT2523941	hsa-miR-575	CLIP-seq
MIRT2523942	hsa-miR-635	CLIP-seq
MIRT2523943	hsa-miR-638	CLIP-seq
MIRT2523944	hsa-miR-642a	CLIP-seq
MIRT1985652	hsa-miR-642b	CLIP-seq
MIRT2523945	hsa-miR-765	CLIP-seq
MIRT2523946	hsa-miR-769-3p	CLIP-seq
MIRT2523947	hsa-miR-877	CLIP-seq
MIRT2523948	hsa-miR-93	CLIP-seq
MIRT2523949	hsa-miR-939	CLIP-seq
MIRT2523859	hsa-miR-106a	CLIP-seq
MIRT2523860	hsa-miR-106b	CLIP-seq
MIRT2523861	hsa-miR-1207-3p	CLIP-seq
MIRT2523862	hsa-miR-1224-3p	CLIP-seq
MIRT2523863	hsa-miR-1260	CLIP-seq
MIRT2523864	hsa-miR-1260b	CLIP-seq
MIRT2523865	hsa-miR-1280	CLIP-seq
MIRT1985627	hsa-miR-1295	CLIP-seq
MIRT2523866	hsa-miR-1301	CLIP-seq
MIRT1985628	hsa-miR-1302	CLIP-seq
MIRT963611	hsa-miR-139-5p	CLIP-seq
MIRT2523867	hsa-miR-17	CLIP-seq
MIRT2523868	hsa-miR-185	CLIP-seq
MIRT2523869	hsa-miR-1972	CLIP-seq
MIRT2523870	hsa-miR-20a	CLIP-seq
MIRT2523871	hsa-miR-20b	CLIP-seq
MIRT2523872	hsa-miR-2110	CLIP-seq
MIRT2523873	hsa-miR-23a	CLIP-seq
MIRT2523874	hsa-miR-23b	CLIP-seq
MIRT2523875	hsa-miR-23c	CLIP-seq
MIRT2523876	hsa-miR-296-3p	CLIP-seq
MIRT2523877	hsa-miR-3064-3p	CLIP-seq
MIRT2523878	hsa-miR-3065-3p	CLIP-seq
MIRT2523879	hsa-miR-3115	CLIP-seq
MIRT2523880	hsa-miR-3125	CLIP-seq
MIRT1985629	hsa-miR-3126-5p	CLIP-seq
MIRT2523881	hsa-miR-3135b	CLIP-seq
MIRT2523882	hsa-miR-3150a-3p	CLIP-seq
MIRT2523883	hsa-miR-3163	CLIP-seq
MIRT2523884	hsa-miR-3171	CLIP-seq
MIRT2523885	hsa-miR-3173-3p	CLIP-seq
MIRT2523886	hsa-miR-3175	CLIP-seq
MIRT2523887	hsa-miR-3183	CLIP-seq
MIRT2523888	hsa-miR-3185	CLIP-seq
MIRT1985630	hsa-miR-3190	CLIP-seq
MIRT2523889	hsa-miR-3194-3p	CLIP-seq
MIRT2523890	hsa-miR-330-3p	CLIP-seq
MIRT1985631	hsa-miR-335	CLIP-seq
MIRT2523891	hsa-miR-3591-3p	CLIP-seq
MIRT2523892	hsa-miR-361-3p	CLIP-seq
MIRT2523893	hsa-miR-3622b-5p	CLIP-seq
MIRT2523894	hsa-miR-3675-5p	CLIP-seq
MIRT1985633	hsa-miR-3679-3p	CLIP-seq
MIRT2523895	hsa-miR-3688-5p	CLIP-seq
MIRT2523896	hsa-miR-3691-3p	CLIP-seq
MIRT2523897	hsa-miR-369-3p	CLIP-seq
MIRT2523898	hsa-miR-374a	CLIP-seq
MIRT2523899	hsa-miR-374b	CLIP-seq
MIRT2523900	hsa-miR-3916	CLIP-seq
MIRT2523901	hsa-miR-3944-5p	CLIP-seq
MIRT2523902	hsa-miR-3976	CLIP-seq
MIRT2523903	hsa-miR-3978	CLIP-seq
MIRT1985634	hsa-miR-4257	CLIP-seq
MIRT2523904	hsa-miR-4271	CLIP-seq
MIRT2523905	hsa-miR-4281	CLIP-seq
MIRT1985635	hsa-miR-4298	CLIP-seq
MIRT2523906	hsa-miR-4299	CLIP-seq
MIRT1985636	hsa-miR-4303	CLIP-seq
MIRT2523907	hsa-miR-4306	CLIP-seq
MIRT1985637	hsa-miR-4311	CLIP-seq
MIRT2523908	hsa-miR-4318	CLIP-seq
MIRT1985638	hsa-miR-4328	CLIP-seq
MIRT1985639	hsa-miR-4419a	CLIP-seq
MIRT1985640	hsa-miR-4424	CLIP-seq
MIRT2523909	hsa-miR-4436b-3p	CLIP-seq
MIRT2523910	hsa-miR-4456	CLIP-seq
MIRT2523911	hsa-miR-4468	CLIP-seq
MIRT2523912	hsa-miR-4506	CLIP-seq
MIRT2523913	hsa-miR-450b-3p	CLIP-seq
MIRT1985642	hsa-miR-4510	CLIP-seq
MIRT2523914	hsa-miR-451b	CLIP-seq
MIRT963618	hsa-miR-4640-3p	CLIP-seq
MIRT2523915	hsa-miR-4643	CLIP-seq
MIRT2523916	hsa-miR-4644	CLIP-seq
MIRT1985643	hsa-miR-4648	CLIP-seq
MIRT1985644	hsa-miR-4649-3p	CLIP-seq
MIRT2523917	hsa-miR-4649-5p	CLIP-seq
MIRT2523918	hsa-miR-4650-5p	CLIP-seq
MIRT2523919	hsa-miR-4660	CLIP-seq
MIRT2523922	hsa-miR-4696	CLIP-seq
MIRT2523923	hsa-miR-4704-5p	CLIP-seq
MIRT2523924	hsa-miR-4713-3p	CLIP-seq
MIRT2523925	hsa-miR-4717-3p	CLIP-seq
MIRT1985645	hsa-miR-4717-5p	CLIP-seq
MIRT2523926	hsa-miR-4723-3p	CLIP-seq
MIRT2523927	hsa-miR-4725-3p	CLIP-seq
MIRT2523928	hsa-miR-4725-5p	CLIP-seq
MIRT963621	hsa-miR-4728-3p	CLIP-seq
MIRT2523929	hsa-miR-4732-3p	CLIP-seq
MIRT2523931	hsa-miR-4761-3p	CLIP-seq
MIRT1985646	hsa-miR-4762-3p	CLIP-seq
MIRT2523932	hsa-miR-4773	CLIP-seq
MIRT2523933	hsa-miR-4779	CLIP-seq
MIRT2523934	hsa-miR-4795-5p	CLIP-seq
MIRT2523935	hsa-miR-500a	CLIP-seq
MIRT2523936	hsa-miR-504	CLIP-seq
MIRT2523937	hsa-miR-5047	CLIP-seq
MIRT2523938	hsa-miR-519d	CLIP-seq
MIRT2523939	hsa-miR-532-3p	CLIP-seq
MIRT2523940	hsa-miR-548q	CLIP-seq
MIRT2523942	hsa-miR-635	CLIP-seq
MIRT2523943	hsa-miR-638	CLIP-seq
MIRT2523944	hsa-miR-642a	CLIP-seq
MIRT1985652	hsa-miR-642b	CLIP-seq
MIRT2523945	hsa-miR-765	CLIP-seq
MIRT2523946	hsa-miR-769-3p	CLIP-seq
MIRT2523947	hsa-miR-877	CLIP-seq
MIRT2523948	hsa-miR-93	CLIP-seq
MIRT2523949	hsa-miR-939	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000015	Component	Phosphopyruvate hydratase complex	IBA
GO:0000015	Component	Phosphopyruvate hydratase complex	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0004634	Function	Phosphopyruvate hydratase activity	IBA
GO:0004634	Function	Phosphopyruvate hydratase activity	IEA
GO:0004634	Function	Phosphopyruvate hydratase activity	ISS	22087329
GO:0004634	Function	Phosphopyruvate hydratase activity	TAS	2045099
GO:0005515	Function	Protein binding	IPI	21044950, 28514442, 33961781, 35271311
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006094	Process	Gluconeogenesis	TAS
GO:0006096	Process	Glycolytic process	IBA
GO:0006096	Process	Glycolytic process	IEA
GO:0006096	Process	Glycolytic process	ISS	22087329
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IDA	19433310
GO:0016020	Component	Membrane	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0030426	Component	Growth cone	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061621	Process	Canonical glycolysis	IEA
GO:0061621	Process	Canonical glycolysis	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0097060	Component	Synaptic membrane	IEA

MIM	HGNC	e!Ensembl
131360	3353	ENSG00000111674

P09104

Protein name

Gamma-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Enolase 2) (Neural enolase) (Neuron-specific enolase) (NSE)

Protein function

Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival (By similarity).

PDB

1TE6 , 2AKM , 2AKZ , 3UCC , 3UCD , 3UJE , 3UJF , 3UJR , 3UJS , 4ZA0 , 4ZCW , 5EU9 , 5IDZ , 5TD9 , 5TIJ , 7MBH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03952	Enolase_N	3 → 134	Enolase, N-terminal domain	Domain
PF00113	Enolase_C	142 → 432	Enolase, C-terminal TIM barrel domain	Domain

Tissue specificity

TISSUE SPECIFICITY: The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.

Sequence

MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGK
GVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCK
AGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRD
AMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKI
VIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDD
WAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLA
QENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL

Sequence length

434

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Metabolic pathways Carbon metabolism Biosynthesis of amino acids RNA degradation HIF-1 signaling pathway Cytoskeleton in muscle cells		Glycolysis Gluconeogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENO2-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (222)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Cerebrovascular Accidents	Stroke	BEFREE	16960091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute encephalopathy	Encephalopathy	BEFREE	21647847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27409171, 29689546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28877268, 29765230, 30115364, 30458812, 30849967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11299750, 23683536, 30673691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	2121537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	20421238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	24410807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27409171, 29689546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31191019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	31690408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	12353304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19072283, 31984950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	9880081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	11740050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	28931055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29515128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30185093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial myxoma familial	Atrial myxoma	Pubtator	1531423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31812776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	24737292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24737292	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31642468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11221851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	22613180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	28671048	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	31418324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	33123300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	38185573	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	29244749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28969023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	7627931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1847122, 31285868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19167937, 24004513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	37047601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	3766707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	21319031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11740050, 28972818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36362375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11162866, 18823584, 19713034, 25422226, 26260621, 26605916, 28064043, 28110687, 28152979, 28229299, 28671048, 29247745, 29729229, 29780629, 29904421 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37724407	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32398667, 39682758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20462442, 28972818, 33564363, 39348357, 8486529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36419844, 36562383, 3766707	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	12656306, 21203907, 2986665, 7514029, 9880081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25520076, 28877268	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	14535589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	16394288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	31513314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	31418324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18830828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	16960091, 26605916, 27816188, 30125595, 30191604, 30669174, 31356182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27409171, 29689546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	31690408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Insomnia	Insomnia	BEFREE	29957487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28858130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30967137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32703926	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33934428, 35954207, 36915998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	28571730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	29665652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30926147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28233444, 30008862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	10519881, 18339451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	27816188, 28569132, 29477456, 29482596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21822534, 24733614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18837957, 21822534, 24733614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	31067852	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28812028, 35898457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31067852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28133696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	28056586, 29484801, 31067852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	31067852	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28744310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	18837957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31191019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	21149784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15068247, 15068251, 8239286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Empyema Pleural	Emphysema	Pubtator	11985791	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	10337919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	11983209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	40124382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29028517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	38203674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	21638339, 30860117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29239210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	16105888	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	10492040, 10782408, 14984937, 2174403, 8636006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	BEFREE	30906755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	15246822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	30286478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	22272335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	30838543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	35366826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17233837, 22185371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22895339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22895339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22185371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	29689546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type VI	Glycogen Storage Disease	BEFREE	21149784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	27271274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	26530364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30926147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27488410	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	28139502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	30191604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28133696, 30430888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31540352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22185371, 31417010, 36419844	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36362375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28931055, 29568675, 29871657, 31182397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28858130, 28951142, 29957487, 30309327, 31733322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26530364, 28724745, 29997237, 30125595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	24733614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	21873362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber Congenital Amaurosis	BEFREE	21149784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11030212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29689546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11030212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	30236862		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	BEFREE	31733322		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	26260621, 28969076, 31642468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33167712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32049748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12636057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	2165922, 24126619, 25422226, 25520076, 27072222, 28671048, 33691944, 34721827, 34791810, 35543090, 35884238, 36966704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22359203, 23992005, 24796851, 35522136	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24126619, 30250539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32141647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11985791, 12353304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31191019, 8539236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31142907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31285868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11162866, 18823584, 19713034, 25422226, 26260621, 26605916, 28064043, 28110687, 28152979, 28229299, 28671048, 29247745, 29729229, 29780629, 29904421 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20219091, 25686823, 28319070, 28885659, 30286478, 8204007, 8543402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	22613180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10657486, 20421238, 28133696, 29755405, 30374596, 30570883, 31394980, 31642468, 9690535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	30115364		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26530364, 8687128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34257527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	2649132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	26514459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	8539236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29643166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31683478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24796851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	23455181, 28854885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29960662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	31067852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33342344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11162866, 11948969, 12162413, 20204716, 20421238, 2156602, 2189293, 22613180, 22949944, 23573331, 2475240, 2557616, 2641280, 26530364, 26662423 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15166674		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29329729, 31067852, 31394980, 31733322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11285617, 12110339, 1334198, 15181182, 2542141, 26032516, 26530364, 2830484, 28465480, 29737901, 29905010, 31220430, 8242553, 8964164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14716776, 16443729, 29737901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
NEURODEGENERATION WITH BRAIN IRON ACCUMULATION 5	Neurodegeneration With Brain Iron Accumulation	BEFREE	26481852, 28711740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29463007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	29191920, 8636006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21814484, 26530364, 28315508, 29191920, 29737901, 30115364, 30667365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	LHGDN	18063947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	24733614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16340245, 19713034, 23065601, 23996295, 26200270, 26530364, 27072585, 28121629, 28607926, 28967066, 29113814, 29308305, 29869537, 29989303, 30214557 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	21595568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21822534		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	31690408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	10619458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	22893673	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	22893673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32398667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	BEFREE	28220397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	30570883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	30570883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	30236862		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	31733322		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	24733614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	24733614		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31571092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pineal Gland Neoplasm	Pineal Gland Neoplasm	BEFREE	20418777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28240844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27409171, 29689546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	19444528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31571092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20219091, 25686823, 28885659, 30286478, 8204007, 8543402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11389966, 33455105, 35905714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	intracranial hypertension	BEFREE	28220397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	31827650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34321876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28972818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11775244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32521926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	17635839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	8780893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	29641463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	29641463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	24293381, 35621141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	31969437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18460190, 27122041		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18460190		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19405953	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	29155421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	38203674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	23621429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	24470708	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11299750, 15234231, 16330929, 23683536, 2438285, 25996920, 26530364, 26886220, 27180266, 28121629, 28127669, 28186176, 2830484, 28412662, 28967066 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	10622207, 1333786, 15335184, 25422226, 25996920, 28448532, 2849799, 29145241, 33488842, 33880365, 34397927, 34790052, 36036563, 36705363, 7993838, 8792853 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28121629	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27072585, 28607926, 29247745, 30115364, 30250539, 31393394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28943424, 29801873		★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	28107595		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	18460022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis of cerebral veins	Thrombosis	BEFREE	29128928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	32141647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	30838543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	8099896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31142907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29244749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	BEFREE	29128928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	19587696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	31690408		★★★★★ ★☆☆☆☆ Found in Text Mining only

ENO2 (enolase 2)