Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2023
Gene name	Enolase 1
Gene symbol	ENO1
Synonyms (NCBI Gene)	ENO1-IT1ENO1L1HEL-S-17MPB1NNEPPH
Chromosome	1
Chromosome location	1p36.23
Summary	This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural l

329

Show/Hide all (329)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049082	hsa-miR-92a-3p	CLASH	23622248
MIRT047021	hsa-miR-204-5p	CLASH	23622248
MIRT046821	hsa-miR-222-3p	CLASH	23622248
MIRT045746	hsa-miR-125a-5p	CLASH	23622248
MIRT043896	hsa-miR-378a-3p	CLASH	23622248
MIRT041760	hsa-miR-484	CLASH	23622248
MIRT041760	hsa-miR-484	CLASH	23622248
MIRT041167	hsa-miR-181d-5p	CLASH	23622248
MIRT040892	hsa-miR-18a-3p	CLASH	23622248
MIRT039693	hsa-miR-615-3p	CLASH	23622248
MIRT039693	hsa-miR-615-3p	CLASH	23622248
MIRT039693	hsa-miR-615-3p	CLASH	23622248
MIRT037729	hsa-miR-744-5p	CLASH	23622248
MIRT052701	hsa-miR-1260b	CLASH	23622248
MIRT052801	hsa-miR-3177-3p	CLASH	23622248
MIRT734972	hsa-miR-330-5p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRIn situ hybridization	33176280
MIRT737241	hsa-miR-22-3p	Immunohistochemistry (IHC)RNA-seqqRT-PCR	32884340
MIRT737242	hsa-miR-1294	Immunohistochemistry (IHC)RNA-seqqRT-PCR	32884340
MIRT963554	hsa-miR-2467-5p	CLIP-seq
MIRT963555	hsa-miR-3119	CLIP-seq
MIRT963556	hsa-miR-3151	CLIP-seq
MIRT963557	hsa-miR-3160-3p	CLIP-seq
MIRT963558	hsa-miR-3168	CLIP-seq
MIRT963559	hsa-miR-3180	CLIP-seq
MIRT963560	hsa-miR-3180-3p	CLIP-seq
MIRT963561	hsa-miR-3188	CLIP-seq
MIRT963562	hsa-miR-3196	CLIP-seq
MIRT963563	hsa-miR-3663-3p	CLIP-seq
MIRT963564	hsa-miR-3975	CLIP-seq
MIRT963565	hsa-miR-4263	CLIP-seq
MIRT963566	hsa-miR-4275	CLIP-seq
MIRT963567	hsa-miR-4293	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963569	hsa-miR-4487	CLIP-seq
MIRT963570	hsa-miR-4521	CLIP-seq
MIRT963571	hsa-miR-4640-5p	CLIP-seq
MIRT963572	hsa-miR-4655-5p	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT963574	hsa-miR-4726-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963576	hsa-miR-485-5p	CLIP-seq
MIRT963577	hsa-miR-518a-5p	CLIP-seq
MIRT963578	hsa-miR-527	CLIP-seq
MIRT963579	hsa-miR-542-5p	CLIP-seq
MIRT963580	hsa-miR-548aa	CLIP-seq
MIRT963581	hsa-miR-558	CLIP-seq
MIRT963582	hsa-miR-596	CLIP-seq
MIRT963583	hsa-miR-635	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT963585	hsa-miR-143	CLIP-seq
MIRT963586	hsa-miR-2276	CLIP-seq
MIRT963554	hsa-miR-2467-5p	CLIP-seq
MIRT963555	hsa-miR-3119	CLIP-seq
MIRT963556	hsa-miR-3151	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963588	hsa-miR-3165	CLIP-seq
MIRT963559	hsa-miR-3180	CLIP-seq
MIRT963560	hsa-miR-3180-3p	CLIP-seq
MIRT963561	hsa-miR-3188	CLIP-seq
MIRT963562	hsa-miR-3196	CLIP-seq
MIRT963589	hsa-miR-3197	CLIP-seq
MIRT963590	hsa-miR-3609	CLIP-seq
MIRT963591	hsa-miR-3614-5p	CLIP-seq
MIRT963563	hsa-miR-3663-3p	CLIP-seq
MIRT963564	hsa-miR-3975	CLIP-seq
MIRT963592	hsa-miR-3978	CLIP-seq
MIRT963593	hsa-miR-425	CLIP-seq
MIRT963594	hsa-miR-4284	CLIP-seq
MIRT963567	hsa-miR-4293	CLIP-seq
MIRT963595	hsa-miR-4305	CLIP-seq
MIRT963596	hsa-miR-4316	CLIP-seq
MIRT963597	hsa-miR-4420	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963598	hsa-miR-4522	CLIP-seq
MIRT963599	hsa-miR-4649-3p	CLIP-seq
MIRT963572	hsa-miR-4655-5p	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT963600	hsa-miR-4690-5p	CLIP-seq
MIRT963601	hsa-miR-4701-5p	CLIP-seq
MIRT963602	hsa-miR-4717-3p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963604	hsa-miR-4770	CLIP-seq
MIRT963605	hsa-miR-4787-5p	CLIP-seq
MIRT963576	hsa-miR-485-5p	CLIP-seq
MIRT963579	hsa-miR-542-5p	CLIP-seq
MIRT963580	hsa-miR-548aa	CLIP-seq
MIRT963606	hsa-miR-548ah	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963581	hsa-miR-558	CLIP-seq
MIRT963608	hsa-miR-588	CLIP-seq
MIRT963582	hsa-miR-596	CLIP-seq
MIRT963609	hsa-miR-663b	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT963586	hsa-miR-2276	CLIP-seq
MIRT1556306	hsa-miR-3137	CLIP-seq
MIRT963556	hsa-miR-3151	CLIP-seq
MIRT1556307	hsa-miR-3686	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT963605	hsa-miR-4787-5p	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963581	hsa-miR-558	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT1985617	hsa-miR-22	CLIP-seq
MIRT963554	hsa-miR-2467-5p	CLIP-seq
MIRT963555	hsa-miR-3119	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963588	hsa-miR-3165	CLIP-seq
MIRT963561	hsa-miR-3188	CLIP-seq
MIRT963589	hsa-miR-3197	CLIP-seq
MIRT963590	hsa-miR-3609	CLIP-seq
MIRT963591	hsa-miR-3614-5p	CLIP-seq
MIRT963564	hsa-miR-3975	CLIP-seq
MIRT963592	hsa-miR-3978	CLIP-seq
MIRT1985618	hsa-miR-4270	CLIP-seq
MIRT963566	hsa-miR-4275	CLIP-seq
MIRT963567	hsa-miR-4293	CLIP-seq
MIRT1985619	hsa-miR-4300	CLIP-seq
MIRT963596	hsa-miR-4316	CLIP-seq
MIRT963597	hsa-miR-4420	CLIP-seq
MIRT1985620	hsa-miR-4441	CLIP-seq
MIRT1985621	hsa-miR-4453	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT1985622	hsa-miR-4538	CLIP-seq
MIRT963571	hsa-miR-4640-5p	CLIP-seq
MIRT963599	hsa-miR-4649-3p	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT1985623	hsa-miR-4685-5p	CLIP-seq
MIRT963601	hsa-miR-4701-5p	CLIP-seq
MIRT963574	hsa-miR-4726-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963576	hsa-miR-485-5p	CLIP-seq
MIRT963577	hsa-miR-518a-5p	CLIP-seq
MIRT963578	hsa-miR-527	CLIP-seq
MIRT963606	hsa-miR-548ah	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963581	hsa-miR-558	CLIP-seq
MIRT963608	hsa-miR-588	CLIP-seq
MIRT963582	hsa-miR-596	CLIP-seq
MIRT963583	hsa-miR-635	CLIP-seq
MIRT963609	hsa-miR-663b	CLIP-seq
MIRT1985624	hsa-miR-920	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT1985617	hsa-miR-22	CLIP-seq
MIRT1556306	hsa-miR-3137	CLIP-seq
MIRT963556	hsa-miR-3151	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963557	hsa-miR-3160-3p	CLIP-seq
MIRT963588	hsa-miR-3165	CLIP-seq
MIRT963559	hsa-miR-3180	CLIP-seq
MIRT963560	hsa-miR-3180-3p	CLIP-seq
MIRT2220079	hsa-miR-3182	CLIP-seq
MIRT963562	hsa-miR-3196	CLIP-seq
MIRT963589	hsa-miR-3197	CLIP-seq
MIRT963590	hsa-miR-3609	CLIP-seq
MIRT963591	hsa-miR-3614-5p	CLIP-seq
MIRT1556307	hsa-miR-3686	CLIP-seq
MIRT963592	hsa-miR-3978	CLIP-seq
MIRT1985618	hsa-miR-4270	CLIP-seq
MIRT963566	hsa-miR-4275	CLIP-seq
MIRT1985619	hsa-miR-4300	CLIP-seq
MIRT963596	hsa-miR-4316	CLIP-seq
MIRT1985620	hsa-miR-4441	CLIP-seq
MIRT1985621	hsa-miR-4453	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963569	hsa-miR-4487	CLIP-seq
MIRT1985622	hsa-miR-4538	CLIP-seq
MIRT963571	hsa-miR-4640-5p	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT1985623	hsa-miR-4685-5p	CLIP-seq
MIRT963600	hsa-miR-4690-5p	CLIP-seq
MIRT963574	hsa-miR-4726-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963577	hsa-miR-518a-5p	CLIP-seq
MIRT963578	hsa-miR-527	CLIP-seq
MIRT963579	hsa-miR-542-5p	CLIP-seq
MIRT963606	hsa-miR-548ah	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963581	hsa-miR-558	CLIP-seq
MIRT963583	hsa-miR-635	CLIP-seq
MIRT1985624	hsa-miR-920	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT963586	hsa-miR-2276	CLIP-seq
MIRT963556	hsa-miR-3151	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963557	hsa-miR-3160-3p	CLIP-seq
MIRT963588	hsa-miR-3165	CLIP-seq
MIRT963559	hsa-miR-3180	CLIP-seq
MIRT963560	hsa-miR-3180-3p	CLIP-seq
MIRT963562	hsa-miR-3196	CLIP-seq
MIRT963589	hsa-miR-3197	CLIP-seq
MIRT963590	hsa-miR-3609	CLIP-seq
MIRT963591	hsa-miR-3614-5p	CLIP-seq
MIRT963592	hsa-miR-3978	CLIP-seq
MIRT963596	hsa-miR-4316	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963569	hsa-miR-4487	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT963600	hsa-miR-4690-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963605	hsa-miR-4787-5p	CLIP-seq
MIRT963606	hsa-miR-548ah	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963581	hsa-miR-558	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT1985617	hsa-miR-22	CLIP-seq
MIRT963586	hsa-miR-2276	CLIP-seq
MIRT963554	hsa-miR-2467-5p	CLIP-seq
MIRT1556306	hsa-miR-3137	CLIP-seq
MIRT963556	hsa-miR-3151	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963588	hsa-miR-3165	CLIP-seq
MIRT963558	hsa-miR-3168	CLIP-seq
MIRT963559	hsa-miR-3180	CLIP-seq
MIRT963560	hsa-miR-3180-3p	CLIP-seq
MIRT2220079	hsa-miR-3182	CLIP-seq
MIRT963562	hsa-miR-3196	CLIP-seq
MIRT963589	hsa-miR-3197	CLIP-seq
MIRT963590	hsa-miR-3609	CLIP-seq
MIRT963591	hsa-miR-3614-5p	CLIP-seq
MIRT1556307	hsa-miR-3686	CLIP-seq
MIRT963592	hsa-miR-3978	CLIP-seq
MIRT963565	hsa-miR-4263	CLIP-seq
MIRT1985618	hsa-miR-4270	CLIP-seq
MIRT963566	hsa-miR-4275	CLIP-seq
MIRT963594	hsa-miR-4284	CLIP-seq
MIRT1985619	hsa-miR-4300	CLIP-seq
MIRT963595	hsa-miR-4305	CLIP-seq
MIRT963596	hsa-miR-4316	CLIP-seq
MIRT1985620	hsa-miR-4441	CLIP-seq
MIRT1985621	hsa-miR-4453	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963570	hsa-miR-4521	CLIP-seq
MIRT963598	hsa-miR-4522	CLIP-seq
MIRT1985622	hsa-miR-4538	CLIP-seq
MIRT963571	hsa-miR-4640-5p	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT1985623	hsa-miR-4685-5p	CLIP-seq
MIRT963600	hsa-miR-4690-5p	CLIP-seq
MIRT963602	hsa-miR-4717-3p	CLIP-seq
MIRT963574	hsa-miR-4726-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963605	hsa-miR-4787-5p	CLIP-seq
MIRT963577	hsa-miR-518a-5p	CLIP-seq
MIRT963578	hsa-miR-527	CLIP-seq
MIRT963606	hsa-miR-548ah	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963581	hsa-miR-558	CLIP-seq
MIRT963583	hsa-miR-635	CLIP-seq
MIRT1985624	hsa-miR-920	CLIP-seq
MIRT963584	hsa-miR-125a-3p	CLIP-seq
MIRT1985617	hsa-miR-22	CLIP-seq
MIRT963586	hsa-miR-2276	CLIP-seq
MIRT963554	hsa-miR-2467-5p	CLIP-seq
MIRT1556306	hsa-miR-3137	CLIP-seq
MIRT963556	hsa-miR-3151	CLIP-seq
MIRT963587	hsa-miR-3158-3p	CLIP-seq
MIRT963588	hsa-miR-3165	CLIP-seq
MIRT963558	hsa-miR-3168	CLIP-seq
MIRT963559	hsa-miR-3180	CLIP-seq
MIRT963560	hsa-miR-3180-3p	CLIP-seq
MIRT2220079	hsa-miR-3182	CLIP-seq
MIRT963562	hsa-miR-3196	CLIP-seq
MIRT963589	hsa-miR-3197	CLIP-seq
MIRT963590	hsa-miR-3609	CLIP-seq
MIRT963591	hsa-miR-3614-5p	CLIP-seq
MIRT1556307	hsa-miR-3686	CLIP-seq
MIRT963592	hsa-miR-3978	CLIP-seq
MIRT963565	hsa-miR-4263	CLIP-seq
MIRT1985618	hsa-miR-4270	CLIP-seq
MIRT963566	hsa-miR-4275	CLIP-seq
MIRT963594	hsa-miR-4284	CLIP-seq
MIRT1985619	hsa-miR-4300	CLIP-seq
MIRT963595	hsa-miR-4305	CLIP-seq
MIRT963596	hsa-miR-4316	CLIP-seq
MIRT1985620	hsa-miR-4441	CLIP-seq
MIRT1985621	hsa-miR-4453	CLIP-seq
MIRT963568	hsa-miR-4462	CLIP-seq
MIRT963570	hsa-miR-4521	CLIP-seq
MIRT963598	hsa-miR-4522	CLIP-seq
MIRT1985622	hsa-miR-4538	CLIP-seq
MIRT963571	hsa-miR-4640-5p	CLIP-seq
MIRT963573	hsa-miR-4662a-5p	CLIP-seq
MIRT1985623	hsa-miR-4685-5p	CLIP-seq
MIRT963600	hsa-miR-4690-5p	CLIP-seq
MIRT963602	hsa-miR-4717-3p	CLIP-seq
MIRT963574	hsa-miR-4726-5p	CLIP-seq
MIRT963575	hsa-miR-4728-5p	CLIP-seq
MIRT963603	hsa-miR-4763-5p	CLIP-seq
MIRT963605	hsa-miR-4787-5p	CLIP-seq
MIRT963577	hsa-miR-518a-5p	CLIP-seq
MIRT963578	hsa-miR-527	CLIP-seq
MIRT963606	hsa-miR-548ah	CLIP-seq
MIRT963607	hsa-miR-552	CLIP-seq
MIRT963581	hsa-miR-558	CLIP-seq
MIRT963583	hsa-miR-635	CLIP-seq
MIRT1985624	hsa-miR-920	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HIF1A	Activation	8955077

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000015	Component	Phosphopyruvate hydratase complex	IBA
GO:0000015	Component	Phosphopyruvate hydratase complex	IDA	3529090
GO:0000015	Component	Phosphopyruvate hydratase complex	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	2005901
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	2005901
GO:0001222	Function	Transcription corepressor binding	IPI	11134351
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	2005901
GO:0003677	Function	DNA binding	IEA
GO:0003714	Function	Transcription corepressor activity	IDA	11134351
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004634	Function	Phosphopyruvate hydratase activity	IBA
GO:0004634	Function	Phosphopyruvate hydratase activity	IDA	29775581
GO:0004634	Function	Phosphopyruvate hydratase activity	IEA
GO:0004634	Function	Phosphopyruvate hydratase activity	IMP	3529090
GO:0004634	Function	Phosphopyruvate hydratase activity	TAS
GO:0005515	Function	Protein binding	IPI	12666133, 15161933, 17500595, 18194455, 19433310, 20849852, 21274509, 23355646, 23414517, 28514442, 28813417, 32814053, 33961781, 35271311
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IC	2005901, 10082554
GO:0005634	Component	Nucleus	IEA
GO:0005640	Component	Nuclear outer membrane	IDA	11134351
GO:0005737	Component	Cytoplasm	IDA	15459207, 25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12666133, 19433310
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	12666133
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IDA	19433310
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006094	Process	Gluconeogenesis	TAS
GO:0006096	Process	Glycolytic process	IBA
GO:0006096	Process	Glycolytic process	IEA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0009986	Component	Cell surface	IDA	12666133, 19433310
GO:0010756	Process	Positive regulation of plasminogen activation	IMP	12666133
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	19433310
GO:0016020	Component	Membrane	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	10082554
GO:0031430	Component	M band	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	3529090
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10082554, 11134351
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	10681589
GO:0045933	Process	Positive regulation of muscle contraction	IGI	15459207
GO:0046872	Function	Metal ion binding	IEA
GO:0051020	Function	GTPase binding	IPI	24337748
GO:0061621	Process	Canonical glycolysis	IDA	29775581
GO:0061621	Process	Canonical glycolysis	IEA
GO:0061621	Process	Canonical glycolysis	IMP	3529090
GO:0061621	Process	Canonical glycolysis	TAS
GO:0070062	Component	Extracellular exosome	HDA	11487543, 12519789, 19199708, 20458337, 21362503, 23533145
GO:1903298	Process	Negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	IDA	15459207
GO:1903298	Process	Negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	IGI	15459207
GO:2001171	Process	Positive regulation of ATP biosynthetic process	IDA	15459207
GO:2001171	Process	Positive regulation of ATP biosynthetic process	IGI	15459207

MIM	HGNC	e!Ensembl
172430	3350	ENSG00000074800

P06733

Protein name

Alpha-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (C-myc promoter-binding protein) (Enolase 1) (MBP-1) (MPB-1) (Non-neural enolase) (NNE) (Phosphopyruvate hydratase) (Plasminogen-binding protein)

Protein function

Glycolytic enzyme the catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate (PubMed:1369209, PubMed:29775581). In addition to glycolysis, involved in various processes such as growth control, hypoxia tolerance and allergic respon

PDB

2PSN , 3B97 , 5JLZ , 5LAX , 5NI9 , 5NIG , 5OCK , 8TRL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03952	Enolase_N	3 → 134	Enolase, N-terminal domain	Domain
PF00113	Enolase_C	142 → 432	Enolase, C-terminal TIM barrel domain	Domain

Tissue specificity

TISSUE SPECIFICITY: The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.

Sequence

MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGK
GVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK
AGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFRE
AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKV
VIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLA
QANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
AKFAGRNFRNPLAK

Sequence length

434

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Metabolic pathways Carbon metabolism Biosynthesis of amino acids RNA degradation HIF-1 signaling pathway Cytoskeleton in muscle cells		Glycolysis Gluconeogenesis Manipulation of host energy metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENTEROCOLITIS, NECROTIZING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (243)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acrodysostosis	Acrodysostosis	BEFREE	3815876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	21751358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	28412148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27767175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	19381893, 27602772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29090499, 29501774, 29522283, 30673691, 31767835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18752637, 19072283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	27618767		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25860938, 26096821, 29483925, 31396350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29856298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29856298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21953289, 29997113, 30504445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16277695, 18668562, 20506214, 22661643, 22674012, 24965753, 27145822, 31430907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28951633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31157540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11836316, 19898480, 20506214, 21360494, 21953289, 26414764, 28503176, 28728510, 30001173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Pancreatitis	Autoimmune pancreatitis	Pubtator	19940298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33628097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12847697, 14673387, 28770703, 29465373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	12847697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	12847697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31431517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	31151887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	37011206	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19655245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19934312, 20412594, 20886042, 23381546, 23421821, 31416219, 7641187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16048908, 20886042, 22734040, 23421821, 26144282, 27110560, 31329371, 31416219, 31428694, 31957838, 37190091	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	32521855	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	35796020	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	25466511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17284257, 19846662, 28443473, 28456790, 31416219, 33628097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20849415	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10853020		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	20886042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	25805497	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28415822, 30345303, 32084009, 36181125, 38097352, 39457014, 40621461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31431517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17178888, 19713034, 24984566, 29538538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20455595, 26096821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37910256	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23009866, 24504108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17284257, 27767175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28443473	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	31037987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20886042, 23421821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30943007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22552009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22552009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	9649223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31076418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27906678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11318533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18691435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18691435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35445138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26097998, 27996156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18691435, 26097998, 30999858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	22552009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	22552009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	11673836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26037892, 28739731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Crystalline of Schnyder	Corneal dystrophy	Pubtator	16163269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	36295613	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	28967811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15846842, 29084415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	28967811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29430682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29867058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29867058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29867058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31076418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27863088, 28608282, 31076418, 31106201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	38107519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	31119774, 7607651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27436115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	22415234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29430682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25951350, 30698832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	23504277	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22415234, 37612452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35805203	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	27485360, 8824716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enzymopathy	Enzymopathy	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33628097	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33628097	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34016746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17003842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	33628097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	31737203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	19846662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22895339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34234410, 36251833, 36494582, 37011206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37420311	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22895339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29497031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36251833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20435467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30178358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	27801539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27863088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	35805203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	27863088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10848973, 20849415, 27765905	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18329003, 20412594, 25188299, 26882120, 31416219, 35796020, 36140669, 36181125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30178358, 30242159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	17003842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18218721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	BEFREE	12818429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	20886042, 23421821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	30614852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	16083875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	17200661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	31342142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28728510, 8455367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	33374003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	19450578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27906678, 39380054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29286103, 39380054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11318533, 18813785, 30301274, 30345303, 30518748, 30532594, 30541900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18813785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11318533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	33440265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29538538, 30178358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	17178888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19657000, 24984566, 29538538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33374003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28728510, 8455367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	24790181, 31138830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28824297	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	28967811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	20435467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19655245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19934312, 20412594, 20886042, 23381546, 23421821, 31416219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30698832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30301274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17178888, 19713034, 24984566, 29538538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28086938, 28824297, 29483925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15805119, 16762917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15378696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19846662, 23975832, 28548950, 29986635, 30582908, 30930989, 31218757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31431517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15805119, 18691435, 19934312, 21261815, 24602611, 24984566, 26037892, 27485360, 27996156, 28415822, 29180852, 29501774, 29545914, 29924389, 29956637, 30582908, 30660590, 31218757 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18691435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19655245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16048908, 31416219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19655245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19655245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35925486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	26830547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	27605433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30827932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	15274141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	10375612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32024967	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17219105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	18430716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	18430716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18682748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22997098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	CTD_human_DG	18806098		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	16359544, 20412594, 20435467, 20849415, 20886042, 21261815, 21637159, 22552009, 23421821, 23975832, 24684412, 25951350, 26144282, 29308319, 29462900, 31767835, 7641187 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	30813870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	31342142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16359544, 8668335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	16359544, 27765905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	17094902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17178888, 27767175, 28456790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	28821582, 28980718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	28770703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37291167	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasias	Pubtator	20498720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16762917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28086938, 28824297, 29483925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28086938, 31396350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19940298, 20455595, 26096821, 28824297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37910256	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parakeratosis	Parakeratosis	BEFREE	29430682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28086938, 29462900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30001173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15805119, 16762917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15705866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15805119, 16762917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15805119, 22734040, 24391718, 27742740, 35242214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	33351137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	27801539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28739731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29913409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18668562		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18926919, 19898480, 20061955, 20506214, 21360494, 21953289, 22661643, 22674012, 23505239, 24965753, 25138370, 25736363, 27143337, 27342824, 28919520 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19898480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28730771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	20617533, 28404907	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30863411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	8792853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	15846842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17284257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17284257, 36361568, 36614179, 38102653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	10853020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19846662, 23975832, 28548950, 29986635, 30582908, 30930989, 31218757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	36295613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15378696		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	19846662, 28548950, 29986635, 33067426, 36295613, 37083649, 37334727	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	22860099	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	27624754	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroiditis Autoimmune	Thyroiditis	Pubtator	35707546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34440660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37190091	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18218721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31431517, 33176280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35836227	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34530829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	29136018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	8455367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	19587696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ENO1 (enolase 1)