Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	202151
Gene name	RAN binding protein 3 like
Gene symbol	RANBP3L
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5p13.2

Show/Hide all (27)

miRTarBase ID	miRNA	Experiments
MIRT1289623	hsa-miR-3121-3p	CLIP-seq
MIRT1289624	hsa-miR-3159	CLIP-seq
MIRT1289625	hsa-miR-3591-5p	CLIP-seq
MIRT1289626	hsa-miR-3606	CLIP-seq
MIRT1289627	hsa-miR-4709-3p	CLIP-seq
MIRT1289628	hsa-miR-577	CLIP-seq
MIRT1289629	hsa-miR-921	CLIP-seq
MIRT1289623	hsa-miR-3121-3p	CLIP-seq
MIRT1289628	hsa-miR-577	CLIP-seq
MIRT2457729	hsa-miR-223	CLIP-seq
MIRT2457730	hsa-miR-4328	CLIP-seq
MIRT2457731	hsa-miR-4697-3p	CLIP-seq
MIRT2457732	hsa-miR-4778-5p	CLIP-seq
MIRT2607618	hsa-miR-1279	CLIP-seq
MIRT2607619	hsa-miR-21	CLIP-seq
MIRT2607620	hsa-miR-2278	CLIP-seq
MIRT2607621	hsa-miR-300	CLIP-seq
MIRT2607622	hsa-miR-335	CLIP-seq
MIRT2607623	hsa-miR-381	CLIP-seq
MIRT2607624	hsa-miR-410	CLIP-seq
MIRT2607625	hsa-miR-4468	CLIP-seq
MIRT2607626	hsa-miR-4496	CLIP-seq
MIRT2607627	hsa-miR-4760-3p	CLIP-seq
MIRT2607628	hsa-miR-485-3p	CLIP-seq
MIRT2607629	hsa-miR-487a	CLIP-seq
MIRT2607630	hsa-miR-590-5p	CLIP-seq
MIRT2607626	hsa-miR-4496	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006611	Process	Protein export from nucleus	IBA
GO:0045663	Process	Positive regulation of myoblast differentiation	IEA
GO:0045663	Process	Positive regulation of myoblast differentiation	ISS
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	ISS
GO:0046332	Function	SMAD binding	IEA
GO:0046332	Function	SMAD binding	IPI	25755279
GO:1901706	Process	Mesenchymal cell differentiation involved in bone development	IEA
GO:1901706	Process	Mesenchymal cell differentiation involved in bone development	ISS

MIM	HGNC	e!Ensembl
616391	26353	ENSG00000164188

Q86VV4

Protein name

Ran-binding protein 3-like

Protein function

Nuclear export factor for BMP-specific SMAD1/5/8 that plays a critical role in terminating BMP signaling and regulating mesenchymal stem cell differentiation by blocking osteoblast differentiation to promote myogenic differention. Directly recog

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00638	Ran_BP1	288 → 403	RanBP1 domain	Domain

Sequence

MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEA
AEPECNGFPTKRVRSSSFTFHITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSK
HVIRPAILQLPQARSCAKVRKTFGHKALESCKTKEKTNNKISEGNSYLLSENLSRARISV
QLSTNQDFLGATSVGCQPNEDKCSFKSCSSNFVFGENMVERVLGTQKLTQPQLENDSYAK
EKPFKSIPKFPVNFLSSRTDSIKNTSLIESAAAFSSQPSRKCLLEKIDVITGEETEHNVL
KINCKLFIFNKTTQSWIERGRGTLRLNDTASTDCGTLQSRLIMRNQGSLRLILNSKLWAQ
MKIQRANHKNVRITATDLEDYSIKIFLIQASAQDTAYLYAAIHHRLVALQSFNKQRDVNQ
AESLSETAQQLNCESCDENEDDFIQVTKNGSDPSSWTHRQSVACS

Sequence length

465

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28787260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	37873933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28787260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RANBP3L (RAN binding protein 3 like)