CTTN (cortactin)

Gene

• Entrez ID: 2017
• Gene name: Cortactin
• Gene symbol: CTTN
• Synonyms (NCBI Gene): EMS1
• Chromosome: 11
• Chromosome location: 11q13.3
• Summary: This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019566	hsa-miR-340-5p	Sequencing	20371350
MIRT023872	hsa-miR-1-3p	Proteomics	18668040
MIRT023872	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT025473	hsa-miR-34a-5p	Proteomics	21566225
MIRT025473	hsa-miR-34a-5p	Proteomics	21566225
MIRT049499	hsa-miR-92a-3p	CLASH	23622248
MIRT045376	hsa-miR-185-5p	CLASH	23622248
MIRT569538	hsa-miR-6890-3p	PAR-CLIP	20371350
MIRT569537	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT569536	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT569534	hsa-miR-4706	PAR-CLIP	20371350
MIRT569535	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT569533	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT569532	hsa-miR-663a	PAR-CLIP	20371350
MIRT569531	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT060616	hsa-miR-448	PAR-CLIP	21572407
MIRT060621	hsa-miR-548as-3p	PAR-CLIP	21572407
MIRT478516	hsa-miR-548at-3p	PAR-CLIP	21572407
MIRT478515	hsa-miR-548ay-3p	PAR-CLIP	21572407
MIRT060617	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT478514	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT478513	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT478512	hsa-miR-3163	PAR-CLIP	21572407
MIRT478511	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT060619	hsa-miR-4317	PAR-CLIP	21572407
MIRT060623	hsa-miR-6847-3p	PAR-CLIP	21572407
MIRT060615	hsa-miR-153-3p	PAR-CLIP	21572407
MIRT060618	hsa-miR-1178-3p	PAR-CLIP	21572407
MIRT060616	hsa-miR-448	PAR-CLIP	23446348
MIRT060621	hsa-miR-548as-3p	PAR-CLIP	23446348
MIRT478516	hsa-miR-548at-3p	PAR-CLIP	23446348
MIRT478515	hsa-miR-548ay-3p	PAR-CLIP	23446348
MIRT060617	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT478514	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT478513	hsa-miR-338-5p	PAR-CLIP	23446348
MIRT478512	hsa-miR-3163	PAR-CLIP	23446348
MIRT478511	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT060619	hsa-miR-4317	PAR-CLIP	23446348
MIRT060623	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT060615	hsa-miR-153-3p	PAR-CLIP	23446348
MIRT060618	hsa-miR-1178-3p	PAR-CLIP	23446348
MIRT060616	hsa-miR-448	PAR-CLIP	23592263
MIRT478519	hsa-miR-548aa	PAR-CLIP	23592263
MIRT478518	hsa-miR-548ap-3p	PAR-CLIP	23592263
MIRT478517	hsa-miR-548t-3p	PAR-CLIP	23592263
MIRT060621	hsa-miR-548as-3p	PAR-CLIP	23592263
MIRT478516	hsa-miR-548at-3p	PAR-CLIP	23592263
MIRT478515	hsa-miR-548ay-3p	PAR-CLIP	23592263
MIRT060617	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT478514	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT478513	hsa-miR-338-5p	PAR-CLIP	23592263
MIRT478512	hsa-miR-3163	PAR-CLIP	23592263
MIRT478511	hsa-miR-4666a-3p	PAR-CLIP	23592263
MIRT060619	hsa-miR-4317	PAR-CLIP	23592263
MIRT060623	hsa-miR-6847-3p	PAR-CLIP	23592263
MIRT060615	hsa-miR-153-3p	PAR-CLIP	23592263
MIRT060618	hsa-miR-1178-3p	PAR-CLIP	23592263
MIRT732177	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	26952924
MIRT732177	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	26952924
MIRT569538	hsa-miR-6890-3p	PAR-CLIP	20371350
MIRT569537	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT569536	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT569534	hsa-miR-4706	PAR-CLIP	20371350
MIRT569535	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT569533	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT569532	hsa-miR-663a	PAR-CLIP	20371350
MIRT569531	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT060616	hsa-miR-448	PAR-CLIP	21572407
MIRT060621	hsa-miR-548as-3p	PAR-CLIP	21572407
MIRT478516	hsa-miR-548at-3p	PAR-CLIP	21572407
MIRT478515	hsa-miR-548ay-3p	PAR-CLIP	21572407
MIRT060617	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT478514	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT478513	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT478512	hsa-miR-3163	PAR-CLIP	21572407
MIRT478511	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT060619	hsa-miR-4317	PAR-CLIP	21572407
MIRT060623	hsa-miR-6847-3p	PAR-CLIP	21572407
MIRT060615	hsa-miR-153-3p	PAR-CLIP	21572407
MIRT060618	hsa-miR-1178-3p	PAR-CLIP	21572407
MIRT060616	hsa-miR-448	PAR-CLIP	23446348
MIRT060621	hsa-miR-548as-3p	PAR-CLIP	23446348
MIRT478516	hsa-miR-548at-3p	PAR-CLIP	23446348
MIRT478515	hsa-miR-548ay-3p	PAR-CLIP	23446348
MIRT060617	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT478514	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT478513	hsa-miR-338-5p	PAR-CLIP	23446348
MIRT478512	hsa-miR-3163	PAR-CLIP	23446348
MIRT478511	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT060619	hsa-miR-4317	PAR-CLIP	23446348
MIRT060623	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT060615	hsa-miR-153-3p	PAR-CLIP	23446348
MIRT060618	hsa-miR-1178-3p	PAR-CLIP	23446348
MIRT060616	hsa-miR-448	PAR-CLIP	23592263
MIRT478519	hsa-miR-548aa	PAR-CLIP	23592263
MIRT478518	hsa-miR-548ap-3p	PAR-CLIP	23592263
MIRT478517	hsa-miR-548t-3p	PAR-CLIP	23592263
MIRT060621	hsa-miR-548as-3p	PAR-CLIP	23592263
MIRT478516	hsa-miR-548at-3p	PAR-CLIP	23592263
MIRT478515	hsa-miR-548ay-3p	PAR-CLIP	23592263
MIRT060617	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT478514	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT478513	hsa-miR-338-5p	PAR-CLIP	23592263
MIRT478512	hsa-miR-3163	PAR-CLIP	23592263
MIRT478511	hsa-miR-4666a-3p	PAR-CLIP	23592263
MIRT060619	hsa-miR-4317	PAR-CLIP	23592263
MIRT060623	hsa-miR-6847-3p	PAR-CLIP	23592263
MIRT060615	hsa-miR-153-3p	PAR-CLIP	23592263
MIRT060618	hsa-miR-1178-3p	PAR-CLIP	23592263
MIRT916093	hsa-miR-3613-3p	CLIP-seq
MIRT916094	hsa-miR-4427	CLIP-seq
MIRT916095	hsa-miR-4452	CLIP-seq
MIRT916096	hsa-miR-4680-3p	CLIP-seq
MIRT916097	hsa-miR-4775	CLIP-seq
MIRT916098	hsa-miR-4778-5p	CLIP-seq
MIRT916099	hsa-miR-487a	CLIP-seq
MIRT916100	hsa-miR-548c-3p	CLIP-seq
MIRT916101	hsa-miR-1185	CLIP-seq
MIRT916102	hsa-miR-1224-3p	CLIP-seq
MIRT916103	hsa-miR-1224-5p	CLIP-seq
MIRT916104	hsa-miR-1271	CLIP-seq
MIRT916105	hsa-miR-1294	CLIP-seq
MIRT916106	hsa-miR-142-3p	CLIP-seq
MIRT916107	hsa-miR-143	CLIP-seq
MIRT916108	hsa-miR-182	CLIP-seq
MIRT916109	hsa-miR-1908	CLIP-seq
MIRT916110	hsa-miR-3130-3p	CLIP-seq
MIRT916111	hsa-miR-3132	CLIP-seq
MIRT916112	hsa-miR-3137	CLIP-seq
MIRT916113	hsa-miR-3145-3p	CLIP-seq
MIRT916114	hsa-miR-3605-5p	CLIP-seq
MIRT916093	hsa-miR-3613-3p	CLIP-seq
MIRT916115	hsa-miR-3679-5p	CLIP-seq
MIRT916116	hsa-miR-377	CLIP-seq
MIRT916117	hsa-miR-4286	CLIP-seq
MIRT916118	hsa-miR-4290	CLIP-seq
MIRT916119	hsa-miR-4316	CLIP-seq
MIRT916120	hsa-miR-4325	CLIP-seq
MIRT916121	hsa-miR-4451	CLIP-seq
MIRT916122	hsa-miR-4459	CLIP-seq
MIRT916123	hsa-miR-4470	CLIP-seq
MIRT916124	hsa-miR-4530	CLIP-seq
MIRT916125	hsa-miR-4660	CLIP-seq
MIRT916126	hsa-miR-4661-3p	CLIP-seq
MIRT916127	hsa-miR-4685-5p	CLIP-seq
MIRT916128	hsa-miR-4687-5p	CLIP-seq
MIRT916129	hsa-miR-4751	CLIP-seq
MIRT916130	hsa-miR-4770	CLIP-seq
MIRT916131	hsa-miR-4779	CLIP-seq
MIRT916132	hsa-miR-4783-3p	CLIP-seq
MIRT916133	hsa-miR-4793-3p	CLIP-seq
MIRT916134	hsa-miR-648	CLIP-seq
MIRT916135	hsa-miR-663	CLIP-seq
MIRT916136	hsa-miR-765	CLIP-seq
MIRT916137	hsa-miR-96	CLIP-seq
MIRT916138	hsa-miR-1283	CLIP-seq
MIRT916139	hsa-miR-3614-3p	CLIP-seq
MIRT916116	hsa-miR-377	CLIP-seq
MIRT916140	hsa-miR-3908	CLIP-seq
MIRT916141	hsa-miR-3938	CLIP-seq
MIRT916142	hsa-miR-4422	CLIP-seq
MIRT916143	hsa-miR-4711-5p	CLIP-seq
MIRT916144	hsa-miR-545	CLIP-seq
MIRT916145	hsa-miR-548l	CLIP-seq
MIRT916146	hsa-miR-548n	CLIP-seq
MIRT916147	hsa-miR-548p	CLIP-seq
MIRT1971652	hsa-miR-1182	CLIP-seq
MIRT916103	hsa-miR-1224-5p	CLIP-seq
MIRT916104	hsa-miR-1271	CLIP-seq
MIRT916107	hsa-miR-143	CLIP-seq
MIRT916108	hsa-miR-182	CLIP-seq
MIRT1971653	hsa-miR-210	CLIP-seq
MIRT916111	hsa-miR-3132	CLIP-seq
MIRT916113	hsa-miR-3145-3p	CLIP-seq
MIRT1971654	hsa-miR-3148	CLIP-seq
MIRT916121	hsa-miR-4451	CLIP-seq
MIRT916122	hsa-miR-4459	CLIP-seq
MIRT916123	hsa-miR-4470	CLIP-seq
MIRT1971655	hsa-miR-4481	CLIP-seq
MIRT916143	hsa-miR-4711-5p	CLIP-seq
MIRT1971656	hsa-miR-4745-5p	CLIP-seq
MIRT916129	hsa-miR-4751	CLIP-seq
MIRT916130	hsa-miR-4770	CLIP-seq
MIRT916131	hsa-miR-4779	CLIP-seq
MIRT1971657	hsa-miR-520a-5p	CLIP-seq
MIRT1971658	hsa-miR-525-5p	CLIP-seq
MIRT1971659	hsa-miR-548ac	CLIP-seq
MIRT1971660	hsa-miR-548d-3p	CLIP-seq
MIRT1971661	hsa-miR-548z	CLIP-seq
MIRT1971662	hsa-miR-744	CLIP-seq
MIRT916136	hsa-miR-765	CLIP-seq
MIRT916137	hsa-miR-96	CLIP-seq
MIRT916109	hsa-miR-1908	CLIP-seq
MIRT916143	hsa-miR-4711-5p	CLIP-seq
MIRT916135	hsa-miR-663	CLIP-seq
MIRT1971652	hsa-miR-1182	CLIP-seq
MIRT2510611	hsa-miR-1207-5p	CLIP-seq
MIRT916103	hsa-miR-1224-5p	CLIP-seq
MIRT2510612	hsa-miR-1262	CLIP-seq
MIRT916104	hsa-miR-1271	CLIP-seq
MIRT2510613	hsa-miR-1285	CLIP-seq
MIRT2510614	hsa-miR-1343	CLIP-seq
MIRT916107	hsa-miR-143	CLIP-seq
MIRT916108	hsa-miR-182	CLIP-seq
MIRT2510615	hsa-miR-183	CLIP-seq
MIRT916109	hsa-miR-1908	CLIP-seq
MIRT2510616	hsa-miR-1909	CLIP-seq
MIRT2510617	hsa-miR-1915	CLIP-seq
MIRT2510618	hsa-miR-208a	CLIP-seq
MIRT2510619	hsa-miR-208b	CLIP-seq
MIRT1971653	hsa-miR-210	CLIP-seq
MIRT2510620	hsa-miR-224	CLIP-seq
MIRT2510621	hsa-miR-2278	CLIP-seq
MIRT2510622	hsa-miR-3115	CLIP-seq
MIRT2510623	hsa-miR-3117-5p	CLIP-seq
MIRT916110	hsa-miR-3130-3p	CLIP-seq
MIRT916111	hsa-miR-3132	CLIP-seq
MIRT2510624	hsa-miR-3136-3p	CLIP-seq
MIRT916113	hsa-miR-3145-3p	CLIP-seq
MIRT1971654	hsa-miR-3148	CLIP-seq
MIRT2510625	hsa-miR-3167	CLIP-seq
MIRT2510626	hsa-miR-3187-5p	CLIP-seq
MIRT2510627	hsa-miR-329	CLIP-seq
MIRT2510628	hsa-miR-3611	CLIP-seq
MIRT916139	hsa-miR-3614-3p	CLIP-seq
MIRT2510629	hsa-miR-3617	CLIP-seq
MIRT2510630	hsa-miR-3619-3p	CLIP-seq
MIRT2510631	hsa-miR-362-3p	CLIP-seq
MIRT2510632	hsa-miR-3661	CLIP-seq
MIRT2510633	hsa-miR-3667-3p	CLIP-seq
MIRT916116	hsa-miR-377	CLIP-seq
MIRT2510634	hsa-miR-3913-3p	CLIP-seq
MIRT2510635	hsa-miR-3922-5p	CLIP-seq
MIRT2510636	hsa-miR-3945	CLIP-seq
MIRT2510637	hsa-miR-4253	CLIP-seq
MIRT2510638	hsa-miR-4269	CLIP-seq
MIRT2510639	hsa-miR-4276	CLIP-seq
MIRT2510640	hsa-miR-4284	CLIP-seq
MIRT916118	hsa-miR-4290	CLIP-seq
MIRT2510641	hsa-miR-4297	CLIP-seq
MIRT916120	hsa-miR-4325	CLIP-seq
MIRT916121	hsa-miR-4451	CLIP-seq
MIRT916122	hsa-miR-4459	CLIP-seq
MIRT2510642	hsa-miR-4467	CLIP-seq
MIRT916123	hsa-miR-4470	CLIP-seq
MIRT1971655	hsa-miR-4481	CLIP-seq
MIRT2510643	hsa-miR-4504	CLIP-seq
MIRT916124	hsa-miR-4530	CLIP-seq
MIRT2510644	hsa-miR-4645-3p	CLIP-seq
MIRT916128	hsa-miR-4687-5p	CLIP-seq
MIRT2510645	hsa-miR-4690-5p	CLIP-seq
MIRT2510646	hsa-miR-4701-3p	CLIP-seq
MIRT916143	hsa-miR-4711-5p	CLIP-seq
MIRT2510647	hsa-miR-4724-5p	CLIP-seq
MIRT1971656	hsa-miR-4745-5p	CLIP-seq
MIRT916129	hsa-miR-4751	CLIP-seq
MIRT2510648	hsa-miR-4763-3p	CLIP-seq
MIRT916130	hsa-miR-4770	CLIP-seq
MIRT916131	hsa-miR-4779	CLIP-seq
MIRT916132	hsa-miR-4783-3p	CLIP-seq
MIRT916133	hsa-miR-4793-3p	CLIP-seq
MIRT2510649	hsa-miR-486-3p	CLIP-seq
MIRT2510650	hsa-miR-498	CLIP-seq
MIRT2510651	hsa-miR-499-5p	CLIP-seq
MIRT1971657	hsa-miR-520a-5p	CLIP-seq
MIRT1971658	hsa-miR-525-5p	CLIP-seq
MIRT1971659	hsa-miR-548ac	CLIP-seq
MIRT1971660	hsa-miR-548d-3p	CLIP-seq
MIRT1971661	hsa-miR-548z	CLIP-seq
MIRT2510652	hsa-miR-593	CLIP-seq
MIRT2510653	hsa-miR-603	CLIP-seq
MIRT2510654	hsa-miR-606	CLIP-seq
MIRT2510655	hsa-miR-612	CLIP-seq
MIRT2510656	hsa-miR-631	CLIP-seq
MIRT2510657	hsa-miR-641	CLIP-seq
MIRT916135	hsa-miR-663	CLIP-seq
MIRT2510658	hsa-miR-663b	CLIP-seq
MIRT1971662	hsa-miR-744	CLIP-seq
MIRT2510659	hsa-miR-758	CLIP-seq
MIRT916136	hsa-miR-765	CLIP-seq
MIRT2510660	hsa-miR-876-5p	CLIP-seq
MIRT2510661	hsa-miR-922	CLIP-seq
MIRT916137	hsa-miR-96	CLIP-seq
MIRT1971652	hsa-miR-1182	CLIP-seq
MIRT2510611	hsa-miR-1207-5p	CLIP-seq
MIRT916103	hsa-miR-1224-5p	CLIP-seq
MIRT2510612	hsa-miR-1262	CLIP-seq
MIRT916104	hsa-miR-1271	CLIP-seq
MIRT2510613	hsa-miR-1285	CLIP-seq
MIRT2510614	hsa-miR-1343	CLIP-seq
MIRT916107	hsa-miR-143	CLIP-seq
MIRT916108	hsa-miR-182	CLIP-seq
MIRT2510615	hsa-miR-183	CLIP-seq
MIRT916109	hsa-miR-1908	CLIP-seq
MIRT2510616	hsa-miR-1909	CLIP-seq
MIRT2510617	hsa-miR-1915	CLIP-seq
MIRT2510618	hsa-miR-208a	CLIP-seq
MIRT2510619	hsa-miR-208b	CLIP-seq
MIRT1971653	hsa-miR-210	CLIP-seq
MIRT2510620	hsa-miR-224	CLIP-seq
MIRT2510621	hsa-miR-2278	CLIP-seq
MIRT2510622	hsa-miR-3115	CLIP-seq
MIRT2510623	hsa-miR-3117-5p	CLIP-seq
MIRT916110	hsa-miR-3130-3p	CLIP-seq
MIRT916111	hsa-miR-3132	CLIP-seq
MIRT2510624	hsa-miR-3136-3p	CLIP-seq
MIRT916113	hsa-miR-3145-3p	CLIP-seq
MIRT1971654	hsa-miR-3148	CLIP-seq
MIRT2510625	hsa-miR-3167	CLIP-seq
MIRT2510626	hsa-miR-3187-5p	CLIP-seq
MIRT2510627	hsa-miR-329	CLIP-seq
MIRT2510628	hsa-miR-3611	CLIP-seq
MIRT916139	hsa-miR-3614-3p	CLIP-seq
MIRT2510629	hsa-miR-3617	CLIP-seq
MIRT2510630	hsa-miR-3619-3p	CLIP-seq
MIRT2510631	hsa-miR-362-3p	CLIP-seq
MIRT2510632	hsa-miR-3661	CLIP-seq
MIRT2510633	hsa-miR-3667-3p	CLIP-seq
MIRT916116	hsa-miR-377	CLIP-seq
MIRT2510634	hsa-miR-3913-3p	CLIP-seq
MIRT2510635	hsa-miR-3922-5p	CLIP-seq
MIRT2510638	hsa-miR-4269	CLIP-seq
MIRT2510639	hsa-miR-4276	CLIP-seq
MIRT2510640	hsa-miR-4284	CLIP-seq
MIRT916118	hsa-miR-4290	CLIP-seq
MIRT2510641	hsa-miR-4297	CLIP-seq
MIRT916120	hsa-miR-4325	CLIP-seq
MIRT916121	hsa-miR-4451	CLIP-seq
MIRT916122	hsa-miR-4459	CLIP-seq
MIRT2510642	hsa-miR-4467	CLIP-seq
MIRT916123	hsa-miR-4470	CLIP-seq
MIRT1971655	hsa-miR-4481	CLIP-seq
MIRT2510643	hsa-miR-4504	CLIP-seq
MIRT916124	hsa-miR-4530	CLIP-seq
MIRT2510644	hsa-miR-4645-3p	CLIP-seq
MIRT916128	hsa-miR-4687-5p	CLIP-seq
MIRT2510645	hsa-miR-4690-5p	CLIP-seq
MIRT2510646	hsa-miR-4701-3p	CLIP-seq
MIRT916143	hsa-miR-4711-5p	CLIP-seq
MIRT2510647	hsa-miR-4724-5p	CLIP-seq
MIRT1971656	hsa-miR-4745-5p	CLIP-seq
MIRT916129	hsa-miR-4751	CLIP-seq
MIRT2510648	hsa-miR-4763-3p	CLIP-seq
MIRT916130	hsa-miR-4770	CLIP-seq
MIRT916131	hsa-miR-4779	CLIP-seq
MIRT916132	hsa-miR-4783-3p	CLIP-seq
MIRT916133	hsa-miR-4793-3p	CLIP-seq
MIRT2510649	hsa-miR-486-3p	CLIP-seq
MIRT2510650	hsa-miR-498	CLIP-seq
MIRT2510651	hsa-miR-499-5p	CLIP-seq
MIRT1971657	hsa-miR-520a-5p	CLIP-seq
MIRT1971658	hsa-miR-525-5p	CLIP-seq
MIRT1971659	hsa-miR-548ac	CLIP-seq
MIRT1971660	hsa-miR-548d-3p	CLIP-seq
MIRT1971661	hsa-miR-548z	CLIP-seq
MIRT2510652	hsa-miR-593	CLIP-seq
MIRT2510653	hsa-miR-603	CLIP-seq
MIRT2510654	hsa-miR-606	CLIP-seq
MIRT2510655	hsa-miR-612	CLIP-seq
MIRT2510656	hsa-miR-631	CLIP-seq
MIRT2510657	hsa-miR-641	CLIP-seq
MIRT916135	hsa-miR-663	CLIP-seq
MIRT2510658	hsa-miR-663b	CLIP-seq
MIRT1971662	hsa-miR-744	CLIP-seq
MIRT2510659	hsa-miR-758	CLIP-seq
MIRT916136	hsa-miR-765	CLIP-seq
MIRT2510660	hsa-miR-876-5p	CLIP-seq
MIRT2510661	hsa-miR-922	CLIP-seq
MIRT916137	hsa-miR-96	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	ISS
GO:0002102	Component	Podosome	IEA
GO:0005515	Function	Protein binding	IPI	15169891, 15574754, 16636290, 17065230, 17255943, 18387954, 19146815, 19419567, 21220424, 21847094, 22252131, 22282019, 24574519, 24658140, 31980649, 32296183, 33961781
GO:0005522	Function	Profilin binding	IPI	24700464
GO:0005737	Component	Cytoplasm	IDA	10760273, 24700464
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	9054437
GO:0005884	Component	Actin filament	IDA	12151401
GO:0005884	Component	Actin filament	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005905	Component	Clathrin-coated pit	ISS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	IEA
GO:0005938	Component	Cell cortex	IDA	14742709, 24700464
GO:0005938	Component	Cell cortex	IEA
GO:0005938	Component	Cell cortex	ISS
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	IMP	17959782
GO:0006897	Process	Endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0006930	Process	Substrate-dependent cell migration, cell extension	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	12151401
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0016020	Component	Membrane	IEA
GO:0030027	Component	Lamellipodium	IDA	10760273, 12151401
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030054	Component	Cell junction	IEA
GO:0030139	Component	Endocytic vesicle	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0030516	Process	Regulation of axon extension	IEA
GO:0030516	Process	Regulation of axon extension	ISS
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	24700464
GO:0030838	Process	Positive regulation of actin filament polymerization	ISS
GO:0030863	Component	Cortical cytoskeleton	IDA	12151401
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0045202	Component	Synapse	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045987	Process	Positive regulation of smooth muscle contraction	IMP	24700464
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0048041	Process	Focal adhesion assembly	ISS
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0048870	Process	Cell motility	IEA
GO:0048870	Process	Cell motility	ISS
GO:0050921	Process	Positive regulation of chemotaxis	IEA
GO:0060491	Process	Regulation of cell projection assembly	IEA
GO:0070064	Function	Proline-rich region binding	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071933	Function	Arp2/3 complex binding	IEA
GO:0097062	Process	Dendritic spine maintenance	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097581	Process	Lamellipodium organization	IEA
GO:0097581	Process	Lamellipodium organization	ISS
GO:0098794	Component	Postsynapse	IEA
GO:0098871	Component	Postsynaptic actin cytoskeleton	IEA
GO:0098885	Process	Modification of postsynaptic actin cytoskeleton	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099010	Process	Modification of postsynaptic structure	IEA
GO:1901524	Process	Regulation of mitophagy	IEA
GO:1990023	Component	Mitotic spindle midzone	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA

Other IDs

• MIM: 164765
• HGNC: 3338
• e!Ensembl: ENSG00000085733

Protein

• UniProt ID: Q14247
• Protein name: Src substrate cortactin (Amplaxin) (Oncogene EMS1)
• Protein function: Contributes to the organization of the actin cytoskeleton and cell shape (PubMed:21296879). Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of ne
• PDB: 1X69, 2D1X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02218	HS1_rep	83 → 118	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	120 → 155	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	157 → 192	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	194 → 229	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	231 → 266	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	268 → 303	Repeat in HS1/Cortactin	Repeat
  PF02218	HS1_rep	305 → 332	Repeat in HS1/Cortactin	Repeat
  PF14604	SH3_9	499 → 547	Variant SH3 domain	Domain

• Sequence:

  MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
  NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
  FGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
  KTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
  DRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQ
  DYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKE
  KEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPV
  YEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYP
  AEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGL
  FPANYVELRQ

• Sequence length: 550

Pathways

KEGG:

Tight junction
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Proteoglycans in cancer

Reactome:

Clathrin-mediated endocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30573781		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16815198		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21474972, 24867096		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21474972		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	17113340		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	39941035	Inhibit	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30976201		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	17113340		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18521921		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18521921		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18521921	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35059464	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30458196		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	24532043, 30458196		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	8622895		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11064458, 11250710, 11559568, 12739008, 12755491, 15719014, 16540652, 16636290, 20213079, 24861866, 26151562, 28364518, 29774130, 30443182, 30562756, 8474448, 8945620, 9054437, 9380415, 9747885		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18403644, 19589785, 20219074, 24753582, 26166158, 26447611, 27026610, 28356423, 30562756, 36043996, 36137995, 9054437	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	1532244, 16280034, 16912177, 18268491, 18324357, 20579220, 21419472, 28885660, 7607576		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12552080, 23518204, 25958313, 31138777, 33466191	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14648664, 8622895		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	18268491, 29654156		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21503569, 29986736		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25527159	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27877079, 30804117	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24532043, 28419476, 30181811, 30458196		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	29534838		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24105619, 24465712, 26134506, 26151562		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19242064, 24465712	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24105619, 27805253, 27903975		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16261345		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17192196, 24465712, 26134506	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24465712		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23553616		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Deglutition disorder	Pubtator	34313394	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	34313394	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12739008, 25205106, 25212831, 30107961		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12739008, 25205106, 25212831		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	40282339	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24551190, 31815134, 32252688, 34962019	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22249020, 26238396, 29949161		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29949161, 32035133	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32791747	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	30458196		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29878474		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20443891	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23553616		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	32727880	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24477234, 30562756	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28120846		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	17641416, 18268491	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28885660		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24532043	Associate	★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	17005439, 27148699		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	CTD_human_DG	27148699		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19666237, 27653309, 29878474		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12552080, 23518204, 24296779, 31138777		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	34313394	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29986736, 38198957	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18268491, 28885660	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21562571, 24551190, 27603901	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	30573781		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	30458196		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29878474		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	30458196		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11250710, 11559568, 12739008, 12755491, 15719014, 16636290, 20213079, 24861866, 26151562, 28364518, 29774130, 30443182, 30562756, 8474448, 8945620, 9380415, 9747885		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12739008, 25205106, 25212831		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29654156		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12552080, 15942670		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21503569, 29986736		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27653309, 29878474		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22050448		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20579220, 26151562, 29733519		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	30344309		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14648664, 8622895		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18406052, 20069395, 21858086, 22050448, 23518204, 23957735, 24465712, 24621372, 24867096, 25271301, 26134506, 26238396, 27148699, 27903975, 28131549, 29152154, 29644904, 29986736, 30065298, 30537291, 7607576		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24105619, 24465712, 26134506, 26151562		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11231575, 16536875, 18850005, 22902175, 27148699, 30562756		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16442522, 16652145		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	30458196		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19898426, 21562571		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19898426, 21562571	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23692923	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29068555		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	34313394	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	29534838		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	15942670		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10955801, 11064458, 11568558, 12552080, 16912177, 17005439, 17292556, 18406052, 18607838, 18931703, 18991334, 21079800, 21419472, 21474972, 21503569, 21562571, 22297550, 23957735, 24465712, 24970760, 25212831, 26134506, 26151562, 27148699, 27805253, 27903975, 29201160, 29774130, 29878474, 30107961, 30176876, 30439350, 8552396, 8622895, 9380415		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	18240308		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29986736		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	25271301		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22297550		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22297550	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	18776588	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18776588, 30367951, 31233194	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30976201		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21339745, 32369440	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	27148699		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	31024527		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28423567		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28423567		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30573781		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30573781		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10687853, 22050448		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26112958	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34831092	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29152154		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	26691754	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10955801, 11064458, 11559568, 16235239, 18607838, 18991334, 20069395, 20456385, 21419472, 27148699, 29201160, 29644904, 29878474, 30456890, 30597652, 9054437		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17178864, 18607838, 18931703		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	27148699		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12202983, 17178864, 17487429, 19684620, 24551190, 25205106, 25212831, 31815134		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18268492, 20069395, 20805359, 23146907, 24278325, 24621372, 31927533, 32065407, 34008248, 35951144, 9054437	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33879222	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30537291, 30804117		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16912177, 17909038, 18324357, 18931703, 20149059, 20805359, 24278325, 27903975, 30456890, 30610108, 31661464, 8552396		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20579220, 26151562, 29733519		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18403644, 24867096, 32626753, 34205064, 35770962, 37443302	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29377162		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27603901	Stimulate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	BEFREE	27148699		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	30344309	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29658350	Associate	★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	15385624		★☆☆☆☆ Found in Text Mining only