Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	201633
Gene name	T cell immunoreceptor with Ig and ITIM domains
Gene symbol	TIGIT
Synonyms (NCBI Gene)	VSIG9VSTM3WUCAM
Chromosome	3
Chromosome location	3q13.31
Summary	This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high

229

Show/Hide all (229)

miRTarBase ID	miRNA	Experiments	Reference
MIRT712829	hsa-miR-548g-3p	HITS-CLIP	19536157
MIRT712828	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT712827	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT712826	hsa-miR-5189-3p	HITS-CLIP	19536157
MIRT712825	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT712824	hsa-miR-6802-3p	HITS-CLIP	19536157
MIRT503555	hsa-miR-8485	HITS-CLIP	21572407
MIRT609506	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT609505	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT609504	hsa-miR-603	HITS-CLIP	21572407
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT609503	hsa-miR-3941	HITS-CLIP	21572407
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT503552	hsa-miR-4534	HITS-CLIP	23824327
MIRT503553	hsa-miR-8082	HITS-CLIP	23824327
MIRT503551	hsa-miR-3134	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT503552	hsa-miR-4534	HITS-CLIP	23824327
MIRT503553	hsa-miR-8082	HITS-CLIP	23824327
MIRT503551	hsa-miR-3134	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT503552	hsa-miR-4534	HITS-CLIP	23824327
MIRT503553	hsa-miR-8082	HITS-CLIP	23824327
MIRT503551	hsa-miR-3134	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	PAR-CLIP	23446348
MIRT503554	hsa-miR-383-3p	PAR-CLIP	23446348
MIRT503552	hsa-miR-4534	PAR-CLIP	23446348
MIRT503553	hsa-miR-8082	PAR-CLIP	23446348
MIRT503551	hsa-miR-3134	PAR-CLIP	23446348
MIRT503550	hsa-miR-185-5p	PAR-CLIP	23446348
MIRT503549	hsa-miR-4306	PAR-CLIP	23446348
MIRT503548	hsa-miR-4644	PAR-CLIP	23446348
MIRT503547	hsa-miR-5192	PAR-CLIP	23446348
MIRT712829	hsa-miR-548g-3p	HITS-CLIP	19536157
MIRT712828	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT712827	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT712826	hsa-miR-5189-3p	HITS-CLIP	19536157
MIRT712825	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT712824	hsa-miR-6802-3p	HITS-CLIP	19536157
MIRT503555	hsa-miR-8485	HITS-CLIP	21572407
MIRT609506	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT609505	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT609504	hsa-miR-603	HITS-CLIP	21572407
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT609503	hsa-miR-3941	HITS-CLIP	21572407
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT503552	hsa-miR-4534	HITS-CLIP	23824327
MIRT503553	hsa-miR-8082	HITS-CLIP	23824327
MIRT503551	hsa-miR-3134	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT503552	hsa-miR-4534	HITS-CLIP	23824327
MIRT503553	hsa-miR-8082	HITS-CLIP	23824327
MIRT503551	hsa-miR-3134	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT630200	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	HITS-CLIP	23824327
MIRT609506	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609505	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609504	hsa-miR-603	HITS-CLIP	23824327
MIRT503554	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT503552	hsa-miR-4534	HITS-CLIP	23824327
MIRT503553	hsa-miR-8082	HITS-CLIP	23824327
MIRT503551	hsa-miR-3134	HITS-CLIP	23824327
MIRT609503	hsa-miR-3941	HITS-CLIP	23824327
MIRT503555	hsa-miR-8485	PAR-CLIP	23446348
MIRT503554	hsa-miR-383-3p	PAR-CLIP	23446348
MIRT503552	hsa-miR-4534	PAR-CLIP	23446348
MIRT503553	hsa-miR-8082	PAR-CLIP	23446348
MIRT503551	hsa-miR-3134	PAR-CLIP	23446348
MIRT503550	hsa-miR-185-5p	PAR-CLIP	23446348
MIRT503549	hsa-miR-4306	PAR-CLIP	23446348
MIRT503548	hsa-miR-4644	PAR-CLIP	23446348
MIRT503547	hsa-miR-5192	PAR-CLIP	23446348
MIRT1424798	hsa-miR-1343	CLIP-seq
MIRT1424799	hsa-miR-203	CLIP-seq
MIRT1424800	hsa-miR-210	CLIP-seq
MIRT1424801	hsa-miR-2355-5p	CLIP-seq
MIRT1424802	hsa-miR-3074-5p	CLIP-seq
MIRT1424803	hsa-miR-3120-3p	CLIP-seq
MIRT1424804	hsa-miR-323b-3p	CLIP-seq
MIRT1424805	hsa-miR-4283	CLIP-seq
MIRT1424806	hsa-miR-4489	CLIP-seq
MIRT1424807	hsa-miR-4496	CLIP-seq
MIRT1424808	hsa-miR-5096	CLIP-seq
MIRT1424809	hsa-miR-545	CLIP-seq
MIRT1424810	hsa-miR-548p	CLIP-seq
MIRT1424811	hsa-miR-889	CLIP-seq
MIRT2127259	hsa-miR-3190	CLIP-seq
MIRT2127260	hsa-miR-3978	CLIP-seq
MIRT2127261	hsa-miR-4491	CLIP-seq
MIRT2127262	hsa-miR-4657	CLIP-seq
MIRT2127263	hsa-miR-4701-5p	CLIP-seq
MIRT2127264	hsa-miR-4796-3p	CLIP-seq
MIRT2127265	hsa-miR-588	CLIP-seq
MIRT2349097	hsa-miR-1248	CLIP-seq
MIRT2349098	hsa-miR-3064-3p	CLIP-seq
MIRT1424803	hsa-miR-3120-3p	CLIP-seq
MIRT2349099	hsa-miR-3199	CLIP-seq
MIRT2349100	hsa-miR-329	CLIP-seq
MIRT2349101	hsa-miR-4265	CLIP-seq
MIRT2349102	hsa-miR-4296	CLIP-seq
MIRT2349103	hsa-miR-4322	CLIP-seq
MIRT2349104	hsa-miR-4648	CLIP-seq
MIRT2349105	hsa-miR-4654	CLIP-seq
MIRT2349106	hsa-miR-4724-5p	CLIP-seq
MIRT2349107	hsa-miR-4769-5p	CLIP-seq
MIRT1424809	hsa-miR-545	CLIP-seq
MIRT2693178	hsa-miR-369-3p	CLIP-seq
MIRT2693179	hsa-miR-374a	CLIP-seq
MIRT2693180	hsa-miR-374b	CLIP-seq
MIRT1424810	hsa-miR-548p	CLIP-seq
MIRT2693181	hsa-miR-548t	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	19011627
GO:0005515	Function	Protein binding	IPI	19011627, 21982860, 25465800, 27978489, 28515320, 32296183
GO:0005886	Component	Plasma membrane	IDA	23154388
GO:0005886	Component	Plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	19011627
GO:0016020	Component	Membrane	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	IBA
GO:0032695	Process	Negative regulation of interleukin-12 production	IMP	19011627
GO:0032733	Process	Positive regulation of interleukin-10 production	IBA
GO:0032733	Process	Positive regulation of interleukin-10 production	IMP	19011627
GO:0038023	Function	Signaling receptor activity	IDA	24817116
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	36248894
GO:0042802	Function	Identical protein binding	IPI	27978489
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23154388, 25870599
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23154388
GO:0050868	Process	Negative regulation of T cell activation	IBA
GO:0050868	Process	Negative regulation of T cell activation	IDA	19011627
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050868	Process	Negative regulation of T cell activation	IMP	19011627

MIM	HGNC	e!Ensembl
612859	26838	ENSG00000181847

Q495A1

Protein name

T-cell immunoreceptor with Ig and ITIM domains (V-set and immunoglobulin domain-containing protein 9) (V-set and transmembrane domain-containing protein 3)

Protein function

Inhibitory receptor that plays a role in the modulation of immune responses. Suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells (PubMed:19011627). Upon binding to its ligands PVR/CD155 or NECTIN2/

PDB

3Q0H , 3RQ3 , 3UCR , 3UDW , 5V52 , 7VYT , 8JEL , 8JEN , 8JEO , 8SZY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	28 → 127	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at low levels on peripheral memory and regulatory CD4+ T-cells and NK cells and is up-regulated following activation of these cells (at protein level). {ECO:0000269|PubMed:19011627}.

Sequence

MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWE
QQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTG
RIFLEVLESSVAEHGARFQIPLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLR
RKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFF
TETG

Sequence length

244

Interactions

View interactions

	KEGG
	Cell adhesion molecules

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (117)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	30514251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30882858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	26250578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	38386917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	39662827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28282368, 35967356	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30990587, 36270740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22427644, 26171588, 28515320, 35589883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28900677, 30728325, 31005675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	35733922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	29890552		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30659053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36857067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28472085, 29983831, 31485637, 32602545, 36271406, 36388159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31485637, 33781741, 34249476, 35592706, 36845105, 37077908, 39838375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	28652380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	37573372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36689623, 37649613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25866972, 31485637, 34545095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35799269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	32269065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29296521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30578679	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30713804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30081950, 31090213, 32393998, 35292828, 37945594, 37992442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33634371	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	34247288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	33413573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36199963, 36581816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	37081668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27577071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	38619620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	35094125, 38008725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31607749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	31607749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	39644111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30221069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31090213	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32269065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30221069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28620836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	31007604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31393854	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29960041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	36613701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	29890552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	30733837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	34249476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28515320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30514251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29890552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31069158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31582819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31582819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29308313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35820057, 37919606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34129052, 34211801, 36361619, 36960073, 37928542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35820057	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28893624, 29855615, 30639819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29115974, 30644386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	33413573, 35589883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34510768	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31005675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37978415, 38461541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31005675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31005675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31005675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36980192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	29217528, 37899130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	30659053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	30659053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	30659053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30614027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28883004, 31069158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27793572, 28883004, 30132062, 30221069, 30555485, 30713804, 30733837, 31105707, 31828774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	31429779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25866972, 30046006, 35247927, 35410311, 36980196, 37952520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30880064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31090213	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37952520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	36901697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37239949, 39187595, 39355257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31134049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31134049	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32269065, 36250467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	36651499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36438903, 36913701, 37098551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28258695, 28612942, 29061643, 29197680, 30232519, 30528596, 30555485, 30638415, 30644386, 30733837, 31500665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33303760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32446718, 35186171, 35326415, 37876933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27626490, 37140899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30882858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	38193541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	33767694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30614027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30179225, 33934205, 35465350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33658578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	37017991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	37244912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30990587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	36613701, 36857067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	31423216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31484735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	30638415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	30638415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	39263792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27777979, 38096229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29061643, 31387897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28883004, 31069158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33575321, 34511485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36680216	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38216949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31174611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35413989	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33306195, 35729552, 39201462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	30993893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	29774027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TIGIT (T cell immunoreceptor with Ig and ITIM domains)