Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	201501
Gene name	Zinc finger and BTB domain containing 7C
Gene symbol	ZBTB7C
Synonyms (NCBI Gene)	APM-1APM1ZBTB36ZNF857C
Chromosome	18
Chromosome location	18q21.1

202

Show/Hide all (202)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018542	hsa-miR-335-5p	Microarray	18185580
MIRT621567	hsa-miR-8485	HITS-CLIP	23824327
MIRT642849	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT621566	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT621565	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT621567	hsa-miR-8485	HITS-CLIP	23824327
MIRT642849	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT621566	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT642848	hsa-miR-1972	HITS-CLIP	23824327
MIRT642847	hsa-miR-4650-5p	HITS-CLIP	23824327
MIRT621565	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT621567	hsa-miR-8485	HITS-CLIP	23824327
MIRT621566	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT621565	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT621567	hsa-miR-8485	HITS-CLIP	23824327
MIRT621566	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT621565	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT621567	hsa-miR-8485	HITS-CLIP	23824327
MIRT642849	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT621566	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT621565	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT621567	hsa-miR-8485	HITS-CLIP	23824327
MIRT642849	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT621566	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT642848	hsa-miR-1972	HITS-CLIP	23824327
MIRT642847	hsa-miR-4650-5p	HITS-CLIP	23824327
MIRT621565	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT621567	hsa-miR-8485	HITS-CLIP	23824327
MIRT621566	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT621565	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT621567	hsa-miR-8485	HITS-CLIP	23824327
MIRT621566	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT621565	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT756287	hsa-miR-26a-5p	Luciferase reporter assayWestern blottingqRT-PCR	37562773
MIRT1504787	hsa-miR-1229	CLIP-seq
MIRT1504788	hsa-miR-1238	CLIP-seq
MIRT1504789	hsa-miR-1321	CLIP-seq
MIRT1504790	hsa-miR-1538	CLIP-seq
MIRT1504791	hsa-miR-1827	CLIP-seq
MIRT1504792	hsa-miR-185	CLIP-seq
MIRT1504793	hsa-miR-2110	CLIP-seq
MIRT1504794	hsa-miR-28-5p	CLIP-seq
MIRT1504795	hsa-miR-3120-3p	CLIP-seq
MIRT1504796	hsa-miR-3139	CLIP-seq
MIRT1504797	hsa-miR-3144-5p	CLIP-seq
MIRT1504798	hsa-miR-3150a-3p	CLIP-seq
MIRT1504799	hsa-miR-3173-3p	CLIP-seq
MIRT1504800	hsa-miR-3183	CLIP-seq
MIRT1504801	hsa-miR-3184	CLIP-seq
MIRT1504802	hsa-miR-3191	CLIP-seq
MIRT1504803	hsa-miR-342-3p	CLIP-seq
MIRT1504804	hsa-miR-3612	CLIP-seq
MIRT1504805	hsa-miR-377	CLIP-seq
MIRT1504806	hsa-miR-378g	CLIP-seq
MIRT1504807	hsa-miR-3940-3p	CLIP-seq
MIRT1504808	hsa-miR-3974	CLIP-seq
MIRT1504809	hsa-miR-423-5p	CLIP-seq
MIRT1504810	hsa-miR-4266	CLIP-seq
MIRT1504811	hsa-miR-4270	CLIP-seq
MIRT1504812	hsa-miR-4292	CLIP-seq
MIRT1504813	hsa-miR-4306	CLIP-seq
MIRT1504814	hsa-miR-4419a	CLIP-seq
MIRT1504815	hsa-miR-4420	CLIP-seq
MIRT1504816	hsa-miR-4428	CLIP-seq
MIRT1504817	hsa-miR-4437	CLIP-seq
MIRT1504818	hsa-miR-4441	CLIP-seq
MIRT1504819	hsa-miR-4459	CLIP-seq
MIRT1504820	hsa-miR-4476	CLIP-seq
MIRT1504821	hsa-miR-4510	CLIP-seq
MIRT1504822	hsa-miR-4533	CLIP-seq
MIRT1504823	hsa-miR-4644	CLIP-seq
MIRT1504824	hsa-miR-4652-5p	CLIP-seq
MIRT1504825	hsa-miR-4668-5p	CLIP-seq
MIRT1504826	hsa-miR-4674	CLIP-seq
MIRT1504827	hsa-miR-4695-5p	CLIP-seq
MIRT1504828	hsa-miR-4722-3p	CLIP-seq
MIRT1504829	hsa-miR-4723-3p	CLIP-seq
MIRT1504830	hsa-miR-4728-5p	CLIP-seq
MIRT1504831	hsa-miR-4739	CLIP-seq
MIRT1504832	hsa-miR-4745-3p	CLIP-seq
MIRT1504833	hsa-miR-4747-3p	CLIP-seq
MIRT1504834	hsa-miR-4756-5p	CLIP-seq
MIRT1504835	hsa-miR-493	CLIP-seq
MIRT1504836	hsa-miR-508-5p	CLIP-seq
MIRT1504837	hsa-miR-545	CLIP-seq
MIRT1504838	hsa-miR-548p	CLIP-seq
MIRT1504839	hsa-miR-634	CLIP-seq
MIRT1504840	hsa-miR-650	CLIP-seq
MIRT1504841	hsa-miR-651	CLIP-seq
MIRT1504842	hsa-miR-665	CLIP-seq
MIRT1504843	hsa-miR-708	CLIP-seq
MIRT1504844	hsa-miR-766	CLIP-seq
MIRT1504845	hsa-miR-873	CLIP-seq
MIRT1504788	hsa-miR-1238	CLIP-seq
MIRT1504800	hsa-miR-3183	CLIP-seq
MIRT1504829	hsa-miR-4723-3p	CLIP-seq
MIRT1922504	hsa-miR-4753-3p	CLIP-seq
MIRT1504788	hsa-miR-1238	CLIP-seq
MIRT1504800	hsa-miR-3183	CLIP-seq
MIRT1504829	hsa-miR-4723-3p	CLIP-seq
MIRT1922504	hsa-miR-4753-3p	CLIP-seq
MIRT2151982	hsa-miR-1178	CLIP-seq
MIRT2151983	hsa-miR-1202	CLIP-seq
MIRT2151984	hsa-miR-129-5p	CLIP-seq
MIRT1504800	hsa-miR-3183	CLIP-seq
MIRT2151985	hsa-miR-3664-3p	CLIP-seq
MIRT2151986	hsa-miR-3934	CLIP-seq
MIRT2151987	hsa-miR-3972	CLIP-seq
MIRT2151988	hsa-miR-4423-5p	CLIP-seq
MIRT2151989	hsa-miR-4694-5p	CLIP-seq
MIRT1504829	hsa-miR-4723-3p	CLIP-seq
MIRT2151990	hsa-miR-4755-3p	CLIP-seq
MIRT2151991	hsa-miR-663b	CLIP-seq
MIRT2151992	hsa-miR-767-3p	CLIP-seq
MIRT1504845	hsa-miR-873	CLIP-seq
MIRT2372371	hsa-miR-124	CLIP-seq
MIRT2372372	hsa-miR-1243	CLIP-seq
MIRT2372373	hsa-miR-1254	CLIP-seq
MIRT2372374	hsa-miR-125a-5p	CLIP-seq
MIRT2372375	hsa-miR-125b	CLIP-seq
MIRT2372376	hsa-miR-127-5p	CLIP-seq
MIRT1504792	hsa-miR-185	CLIP-seq
MIRT2372377	hsa-miR-3116	CLIP-seq
MIRT2372378	hsa-miR-3117-5p	CLIP-seq
MIRT2372379	hsa-miR-3169	CLIP-seq
MIRT2372380	hsa-miR-3185	CLIP-seq
MIRT2372381	hsa-miR-3591-3p	CLIP-seq
MIRT2372382	hsa-miR-3611	CLIP-seq
MIRT2372383	hsa-miR-3622a-5p	CLIP-seq
MIRT2372384	hsa-miR-3650	CLIP-seq
MIRT2372385	hsa-miR-3914	CLIP-seq
MIRT2372386	hsa-miR-3915	CLIP-seq
MIRT2372387	hsa-miR-3928	CLIP-seq
MIRT1504808	hsa-miR-3974	CLIP-seq
MIRT2372388	hsa-miR-4254	CLIP-seq
MIRT2372389	hsa-miR-4265	CLIP-seq
MIRT2372390	hsa-miR-4296	CLIP-seq
MIRT1504813	hsa-miR-4306	CLIP-seq
MIRT2372391	hsa-miR-4319	CLIP-seq
MIRT2372392	hsa-miR-4320	CLIP-seq
MIRT2372393	hsa-miR-4322	CLIP-seq
MIRT2372394	hsa-miR-4417	CLIP-seq
MIRT1504814	hsa-miR-4419a	CLIP-seq
MIRT2372395	hsa-miR-4434	CLIP-seq
MIRT2372396	hsa-miR-4436a	CLIP-seq
MIRT2372397	hsa-miR-4446-3p	CLIP-seq
MIRT1504820	hsa-miR-4476	CLIP-seq
MIRT1504821	hsa-miR-4510	CLIP-seq
MIRT2372398	hsa-miR-4515	CLIP-seq
MIRT2372399	hsa-miR-4516	CLIP-seq
MIRT2372400	hsa-miR-4530	CLIP-seq
MIRT2372401	hsa-miR-4640-5p	CLIP-seq
MIRT2372402	hsa-miR-4642	CLIP-seq
MIRT1504823	hsa-miR-4644	CLIP-seq
MIRT2372403	hsa-miR-4700-3p	CLIP-seq
MIRT2372404	hsa-miR-4712-3p	CLIP-seq
MIRT2372405	hsa-miR-4721	CLIP-seq
MIRT2372406	hsa-miR-4726-5p	CLIP-seq
MIRT2372407	hsa-miR-4761-5p	CLIP-seq
MIRT2372408	hsa-miR-4797-5p	CLIP-seq
MIRT2372409	hsa-miR-506	CLIP-seq
MIRT2372410	hsa-miR-513a-5p	CLIP-seq
MIRT2372411	hsa-miR-544b	CLIP-seq
MIRT2372412	hsa-miR-548v	CLIP-seq
MIRT2372413	hsa-miR-564	CLIP-seq
MIRT2372414	hsa-miR-602	CLIP-seq
MIRT2372415	hsa-miR-610	CLIP-seq
MIRT2372416	hsa-miR-625	CLIP-seq
MIRT2372417	hsa-miR-628-5p	CLIP-seq
MIRT2372418	hsa-miR-647	CLIP-seq
MIRT2372419	hsa-miR-664	CLIP-seq
MIRT1504845	hsa-miR-873	CLIP-seq
MIRT2372420	hsa-miR-922	CLIP-seq
MIRT1504797	hsa-miR-3144-5p	CLIP-seq
MIRT2372380	hsa-miR-3185	CLIP-seq
MIRT1504802	hsa-miR-3191	CLIP-seq
MIRT2372382	hsa-miR-3611	CLIP-seq
MIRT2372384	hsa-miR-3650	CLIP-seq
MIRT1504806	hsa-miR-378g	CLIP-seq
MIRT2665400	hsa-miR-4287	CLIP-seq
MIRT1504812	hsa-miR-4292	CLIP-seq
MIRT2665401	hsa-miR-4308	CLIP-seq
MIRT1504817	hsa-miR-4437	CLIP-seq
MIRT2665402	hsa-miR-4469	CLIP-seq
MIRT1504824	hsa-miR-4652-5p	CLIP-seq
MIRT2665403	hsa-miR-4667-5p	CLIP-seq
MIRT1504826	hsa-miR-4674	CLIP-seq
MIRT2665404	hsa-miR-4685-3p	CLIP-seq
MIRT2665405	hsa-miR-4700-5p	CLIP-seq
MIRT1504797	hsa-miR-3144-5p	CLIP-seq
MIRT1504802	hsa-miR-3191	CLIP-seq
MIRT1504806	hsa-miR-378g	CLIP-seq
MIRT2665400	hsa-miR-4287	CLIP-seq
MIRT1504812	hsa-miR-4292	CLIP-seq
MIRT2665401	hsa-miR-4308	CLIP-seq
MIRT1504817	hsa-miR-4437	CLIP-seq
MIRT2665402	hsa-miR-4469	CLIP-seq
MIRT1504824	hsa-miR-4652-5p	CLIP-seq
MIRT2665403	hsa-miR-4667-5p	CLIP-seq
MIRT1504826	hsa-miR-4674	CLIP-seq
MIRT2665404	hsa-miR-4685-3p	CLIP-seq
MIRT2665405	hsa-miR-4700-5p	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	9427755
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
616591	31700	ENSG00000184828

A1YPR0

Protein name

Zinc finger and BTB domain-containing protein 7C (Affected by papillomavirus DNA integration in ME180 cells protein 1) (APM-1) (Zinc finger and BTB domain-containing protein 36) (Zinc finger protein 857C)

Protein function

May be a tumor suppressor gene.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	24 → 129	BTB/POZ domain	Domain
PF00096	zf-C2H2	392 → 414	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	448 → 469	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in normal cervical keratinocytes, and in some cervical carcinoma cell lines. {ECO:0000269|PubMed:9427755}.

Sequence

MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFK
KLFTAGTLASQPYVYEIDFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIV
NVCLEIMEPGGDGGEEDDKEDDDDDEDDDDEEDEEEEEEEEEDDDDDTEDFADQENLPDP
QDISCHQSPSKTDHLTEKAYSDTPRDFPDSFQAGSPGHLGVIRDFSIESLLRENLYPKAN
IPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIKEEEKEELPPP
PPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPWPLVEERKLKP
KASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPY
LCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRG
RKPAAWRAASLLFGPGGPAPDKAAFVMPPALGEVGGHLGGAAVCLPGPSPAKHFLAAPKG
ALSLQELERQFEETQMKLFGRAQLEAERNAGGLLAFALAENVAAARPYFPLPDPWAAGLA
GLPGLAGLNHVASMSEANN

Sequence length

619

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	32193444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15855354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	26542693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	9427755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22565227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33946045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33946045, 37158531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15209773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12354786, 16567542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12354786, 16567542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27374856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10403784, 12354786, 15504979, 15855354, 17980008, 19359061, 27374856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	11571669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33946045	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16567542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	10403784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16944773, 26634484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	GWASCAT_DG	27927641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	26634484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	22253232, 28571744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28571744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22565227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	11304690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	33946045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	11029602, 11571669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11700024, 15843989, 16418740, 16443770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11304690, 9427755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuchal bleb, familial	Nuchal Bleb	BEFREE	10403784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10403784, 11571669, 12354786, 15843989, 16418740, 16944773, 19359061, 19573164, 9765595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	31222731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	22253232, 28571744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	GWASCAT_DG	27927641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	GWASCAT_DG	27927641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	9427755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZBTB7C (zinc finger and BTB domain containing 7C)