MARK2 (microtubule affinity regulating kinase 2)

Gene

• Entrez ID: 2011
• Gene name: Microtubule affinity regulating kinase 2
• Gene symbol: MARK2
• Synonyms (NCBI Gene): EMK-1, EMK1, MRD76, PAR-1, Par-1b, Par1b
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inacti

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048862	hsa-miR-93-5p	CLASH	23622248
MIRT048691	hsa-miR-99a-5p	CLASH	23622248
MIRT044813	hsa-miR-320a	CLASH	23622248
MIRT041517	hsa-miR-193b-3p	CLASH	23622248
MIRT437446	hsa-miR-190a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24009311
MIRT473643	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT473642	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT473641	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT473640	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT473638	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT473639	hsa-miR-4761-3p	PAR-CLIP	23592263
MIRT473637	hsa-miR-4459	PAR-CLIP	23592263
MIRT473636	hsa-miR-7515	PAR-CLIP	23592263
MIRT473635	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT473634	hsa-miR-3202	PAR-CLIP	23592263
MIRT473633	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT473632	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT473631	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT473630	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT181931	hsa-miR-4271	PAR-CLIP	23592263
MIRT181932	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT181935	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT473629	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT473628	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT473627	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT473626	hsa-miR-6774-5p	PAR-CLIP	23592263
MIRT473625	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT473624	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT473623	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT473622	hsa-miR-302a-3p	PAR-CLIP	23592263
MIRT473621	hsa-miR-302b-3p	PAR-CLIP	23592263
MIRT473620	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT473619	hsa-miR-302d-3p	PAR-CLIP	23592263
MIRT473618	hsa-miR-302e	PAR-CLIP	23592263
MIRT473617	hsa-miR-372-3p	PAR-CLIP	23592263
MIRT473616	hsa-miR-373-3p	PAR-CLIP	23592263
MIRT473615	hsa-miR-520a-3p	PAR-CLIP	23592263
MIRT473614	hsa-miR-520b	PAR-CLIP	23592263
MIRT473613	hsa-miR-520c-3p	PAR-CLIP	23592263
MIRT473612	hsa-miR-520d-3p	PAR-CLIP	23592263
MIRT473611	hsa-miR-520e	PAR-CLIP	23592263
MIRT473610	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT473609	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT473607	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT473608	hsa-miR-6132	PAR-CLIP	23592263
MIRT473606	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT473605	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473604	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473603	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT473602	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT473601	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT473600	hsa-miR-4489	PAR-CLIP	23592263
MIRT473599	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT473598	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT473597	hsa-miR-92a-1-5p	PAR-CLIP	23592263
MIRT473596	hsa-miR-2110	PAR-CLIP	23592263
MIRT473595	hsa-miR-6810-5p	PAR-CLIP	23592263
MIRT231222	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT231226	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT473594	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT473593	hsa-miR-450a-2-3p	PAR-CLIP	23592263
MIRT473643	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT473642	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT473641	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT473640	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT473638	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT473639	hsa-miR-4761-3p	PAR-CLIP	23592263
MIRT473637	hsa-miR-4459	PAR-CLIP	23592263
MIRT473636	hsa-miR-7515	PAR-CLIP	23592263
MIRT473635	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT473634	hsa-miR-3202	PAR-CLIP	23592263
MIRT473633	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT473632	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT473631	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT473630	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT181931	hsa-miR-4271	PAR-CLIP	23592263
MIRT181932	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT181935	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT473629	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT473628	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT473627	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT473626	hsa-miR-6774-5p	PAR-CLIP	23592263
MIRT473625	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT473624	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT473623	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT473622	hsa-miR-302a-3p	PAR-CLIP	23592263
MIRT473621	hsa-miR-302b-3p	PAR-CLIP	23592263
MIRT473620	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT473619	hsa-miR-302d-3p	PAR-CLIP	23592263
MIRT473618	hsa-miR-302e	PAR-CLIP	23592263
MIRT473617	hsa-miR-372-3p	PAR-CLIP	23592263
MIRT473616	hsa-miR-373-3p	PAR-CLIP	23592263
MIRT473615	hsa-miR-520a-3p	PAR-CLIP	23592263
MIRT473614	hsa-miR-520b	PAR-CLIP	23592263
MIRT473613	hsa-miR-520c-3p	PAR-CLIP	23592263
MIRT473612	hsa-miR-520d-3p	PAR-CLIP	23592263
MIRT473611	hsa-miR-520e	PAR-CLIP	23592263
MIRT473610	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT473609	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT473607	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT473608	hsa-miR-6132	PAR-CLIP	23592263
MIRT473606	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT473605	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473604	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473603	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT473602	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT473601	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT473600	hsa-miR-4489	PAR-CLIP	23592263
MIRT473599	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT473598	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT473597	hsa-miR-92a-1-5p	PAR-CLIP	23592263
MIRT473596	hsa-miR-2110	PAR-CLIP	23592263
MIRT473595	hsa-miR-6810-5p	PAR-CLIP	23592263
MIRT231222	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT231226	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT473594	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT473593	hsa-miR-450a-2-3p	PAR-CLIP	23592263
MIRT1132557	hsa-miR-1207-5p	CLIP-seq
MIRT1132558	hsa-miR-1224-3p	CLIP-seq
MIRT1132559	hsa-miR-1226	CLIP-seq
MIRT1132560	hsa-miR-1252	CLIP-seq
MIRT1132561	hsa-miR-1260	CLIP-seq
MIRT1132562	hsa-miR-1260b	CLIP-seq
MIRT1132563	hsa-miR-1273d	CLIP-seq
MIRT1132564	hsa-miR-1280	CLIP-seq
MIRT1132565	hsa-miR-1290	CLIP-seq
MIRT1132566	hsa-miR-1321	CLIP-seq
MIRT1132567	hsa-miR-138	CLIP-seq
MIRT1132568	hsa-miR-1538	CLIP-seq
MIRT1132569	hsa-miR-155	CLIP-seq
MIRT1132570	hsa-miR-185	CLIP-seq
MIRT1132571	hsa-miR-193a-3p	CLIP-seq
MIRT1132572	hsa-miR-193b	CLIP-seq
MIRT1132573	hsa-miR-19a	CLIP-seq
MIRT1132574	hsa-miR-19b	CLIP-seq
MIRT1132575	hsa-miR-224	CLIP-seq
MIRT1132576	hsa-miR-302a	CLIP-seq
MIRT1132577	hsa-miR-302b	CLIP-seq
MIRT1132578	hsa-miR-302c	CLIP-seq
MIRT1132579	hsa-miR-302d	CLIP-seq
MIRT1132580	hsa-miR-3125	CLIP-seq
MIRT1132581	hsa-miR-3126-5p	CLIP-seq
MIRT1132582	hsa-miR-3150b-3p	CLIP-seq
MIRT1132583	hsa-miR-3179	CLIP-seq
MIRT1132584	hsa-miR-3190	CLIP-seq
MIRT1132585	hsa-miR-3613-3p	CLIP-seq
MIRT1132586	hsa-miR-365	CLIP-seq
MIRT1132587	hsa-miR-3663-3p	CLIP-seq
MIRT1132588	hsa-miR-3664-5p	CLIP-seq
MIRT1132589	hsa-miR-3675-5p	CLIP-seq
MIRT1132590	hsa-miR-3677-5p	CLIP-seq
MIRT1132591	hsa-miR-372	CLIP-seq
MIRT1132592	hsa-miR-373	CLIP-seq
MIRT1132593	hsa-miR-3916	CLIP-seq
MIRT1132594	hsa-miR-3919	CLIP-seq
MIRT1132595	hsa-miR-3943	CLIP-seq
MIRT1132596	hsa-miR-4252	CLIP-seq
MIRT1132597	hsa-miR-4270	CLIP-seq
MIRT1132598	hsa-miR-4286	CLIP-seq
MIRT1132599	hsa-miR-4290	CLIP-seq
MIRT1132600	hsa-miR-4306	CLIP-seq
MIRT1132601	hsa-miR-4313	CLIP-seq
MIRT1132602	hsa-miR-4419a	CLIP-seq
MIRT1132603	hsa-miR-4441	CLIP-seq
MIRT1132604	hsa-miR-4476	CLIP-seq
MIRT1132605	hsa-miR-4487	CLIP-seq
MIRT1132606	hsa-miR-4510	CLIP-seq
MIRT1132607	hsa-miR-4523	CLIP-seq
MIRT1132608	hsa-miR-4533	CLIP-seq
MIRT1132609	hsa-miR-4632	CLIP-seq
MIRT1132610	hsa-miR-4644	CLIP-seq
MIRT1132611	hsa-miR-4649-5p	CLIP-seq
MIRT1132612	hsa-miR-4675	CLIP-seq
MIRT1132613	hsa-miR-4687-3p	CLIP-seq
MIRT1132614	hsa-miR-4690-3p	CLIP-seq
MIRT1132615	hsa-miR-4701-5p	CLIP-seq
MIRT1132616	hsa-miR-4707-3p	CLIP-seq
MIRT1132617	hsa-miR-4710	CLIP-seq
MIRT1132618	hsa-miR-4714-5p	CLIP-seq
MIRT1132619	hsa-miR-4716-3p	CLIP-seq
MIRT1132620	hsa-miR-4719	CLIP-seq
MIRT1132621	hsa-miR-4739	CLIP-seq
MIRT1132622	hsa-miR-4741	CLIP-seq
MIRT1132623	hsa-miR-4745-3p	CLIP-seq
MIRT1132624	hsa-miR-4752	CLIP-seq
MIRT1132625	hsa-miR-4756-5p	CLIP-seq
MIRT1132626	hsa-miR-4763-3p	CLIP-seq
MIRT1132627	hsa-miR-4773	CLIP-seq
MIRT1132628	hsa-miR-4779	CLIP-seq
MIRT1132629	hsa-miR-4784	CLIP-seq
MIRT1132630	hsa-miR-4786-5p	CLIP-seq
MIRT1132631	hsa-miR-4792	CLIP-seq
MIRT1132632	hsa-miR-4802-5p	CLIP-seq
MIRT1132633	hsa-miR-486-3p	CLIP-seq
MIRT1132634	hsa-miR-513c	CLIP-seq
MIRT1132635	hsa-miR-514b-5p	CLIP-seq
MIRT1132636	hsa-miR-516b	CLIP-seq
MIRT1132637	hsa-miR-519a	CLIP-seq
MIRT1132638	hsa-miR-520a-5p	CLIP-seq
MIRT1132639	hsa-miR-525-5p	CLIP-seq
MIRT1132640	hsa-miR-539	CLIP-seq
MIRT1132641	hsa-miR-548aa	CLIP-seq
MIRT1132642	hsa-miR-548q	CLIP-seq
MIRT1132643	hsa-miR-587	CLIP-seq
MIRT1132644	hsa-miR-588	CLIP-seq
MIRT1132645	hsa-miR-640	CLIP-seq
MIRT1132646	hsa-miR-646	CLIP-seq
MIRT1132647	hsa-miR-922	CLIP-seq
MIRT1132582	hsa-miR-3150b-3p	CLIP-seq
MIRT1132629	hsa-miR-4784	CLIP-seq
MIRT2037761	hsa-miR-1202	CLIP-seq
MIRT2037762	hsa-miR-1289	CLIP-seq
MIRT2037763	hsa-miR-1291	CLIP-seq
MIRT1132566	hsa-miR-1321	CLIP-seq
MIRT2037764	hsa-miR-1324	CLIP-seq
MIRT1132568	hsa-miR-1538	CLIP-seq
MIRT2037765	hsa-miR-1909	CLIP-seq
MIRT2037766	hsa-miR-218	CLIP-seq
MIRT1132576	hsa-miR-302a	CLIP-seq
MIRT1132577	hsa-miR-302b	CLIP-seq
MIRT1132578	hsa-miR-302c	CLIP-seq
MIRT1132579	hsa-miR-302d	CLIP-seq
MIRT1132580	hsa-miR-3125	CLIP-seq
MIRT1132582	hsa-miR-3150b-3p	CLIP-seq
MIRT2037767	hsa-miR-3160-5p	CLIP-seq
MIRT2037768	hsa-miR-3173-5p	CLIP-seq
MIRT2037769	hsa-miR-3175	CLIP-seq
MIRT2037770	hsa-miR-3176	CLIP-seq
MIRT2037771	hsa-miR-3192	CLIP-seq
MIRT2037772	hsa-miR-3194-5p	CLIP-seq
MIRT2037773	hsa-miR-3198	CLIP-seq
MIRT2037774	hsa-miR-361-3p	CLIP-seq
MIRT1132590	hsa-miR-3677-5p	CLIP-seq
MIRT2037775	hsa-miR-371b-3p	CLIP-seq
MIRT1132591	hsa-miR-372	CLIP-seq
MIRT1132592	hsa-miR-373	CLIP-seq
MIRT1132593	hsa-miR-3916	CLIP-seq
MIRT2037776	hsa-miR-3922-3p	CLIP-seq
MIRT2037777	hsa-miR-3942-3p	CLIP-seq
MIRT2037778	hsa-miR-3972	CLIP-seq
MIRT1132597	hsa-miR-4270	CLIP-seq
MIRT2037779	hsa-miR-4294	CLIP-seq
MIRT2037780	hsa-miR-4300	CLIP-seq
MIRT2037781	hsa-miR-4309	CLIP-seq
MIRT1132602	hsa-miR-4419a	CLIP-seq
MIRT1132603	hsa-miR-4441	CLIP-seq
MIRT1132604	hsa-miR-4476	CLIP-seq
MIRT1132606	hsa-miR-4510	CLIP-seq
MIRT1132609	hsa-miR-4632	CLIP-seq
MIRT2037782	hsa-miR-4640-5p	CLIP-seq
MIRT1132611	hsa-miR-4649-5p	CLIP-seq
MIRT2037783	hsa-miR-4651	CLIP-seq
MIRT2037784	hsa-miR-4663	CLIP-seq
MIRT1132612	hsa-miR-4675	CLIP-seq
MIRT1132616	hsa-miR-4707-3p	CLIP-seq
MIRT2037785	hsa-miR-4708-3p	CLIP-seq
MIRT2037786	hsa-miR-4709-3p	CLIP-seq
MIRT2037787	hsa-miR-4726-5p	CLIP-seq
MIRT1132621	hsa-miR-4739	CLIP-seq
MIRT1132622	hsa-miR-4741	CLIP-seq
MIRT1132623	hsa-miR-4745-3p	CLIP-seq
MIRT2037788	hsa-miR-4753-3p	CLIP-seq
MIRT1132625	hsa-miR-4756-5p	CLIP-seq
MIRT1132628	hsa-miR-4779	CLIP-seq
MIRT2037789	hsa-miR-4781-5p	CLIP-seq
MIRT1132629	hsa-miR-4784	CLIP-seq
MIRT2037790	hsa-miR-4787-5p	CLIP-seq
MIRT2037791	hsa-miR-4797-5p	CLIP-seq
MIRT1132637	hsa-miR-519a	CLIP-seq
MIRT1132638	hsa-miR-520a-5p	CLIP-seq
MIRT1132639	hsa-miR-525-5p	CLIP-seq
MIRT2037792	hsa-miR-543	CLIP-seq
MIRT2037793	hsa-miR-556-3p	CLIP-seq
MIRT2037794	hsa-miR-608	CLIP-seq
MIRT2037795	hsa-miR-636	CLIP-seq
MIRT1132645	hsa-miR-640	CLIP-seq
MIRT2037796	hsa-miR-661	CLIP-seq
MIRT2037797	hsa-miR-759	CLIP-seq
MIRT2037798	hsa-miR-765	CLIP-seq
MIRT2037799	hsa-miR-920	CLIP-seq
MIRT2037800	hsa-miR-939	CLIP-seq
MIRT2267827	hsa-miR-1253	CLIP-seq
MIRT2037765	hsa-miR-1909	CLIP-seq
MIRT2267828	hsa-miR-214	CLIP-seq
MIRT2037769	hsa-miR-3175	CLIP-seq
MIRT2267829	hsa-miR-329	CLIP-seq
MIRT2267830	hsa-miR-3619-5p	CLIP-seq
MIRT2267831	hsa-miR-4434	CLIP-seq
MIRT2267832	hsa-miR-4516	CLIP-seq
MIRT2037783	hsa-miR-4651	CLIP-seq
MIRT2267833	hsa-miR-4693-3p	CLIP-seq
MIRT1132628	hsa-miR-4779	CLIP-seq
MIRT2037794	hsa-miR-608	CLIP-seq
MIRT2267834	hsa-miR-761	CLIP-seq
MIRT2037765	hsa-miR-1909	CLIP-seq
MIRT2267835	hsa-miR-1913	CLIP-seq
MIRT2267828	hsa-miR-214	CLIP-seq
MIRT2267836	hsa-miR-3127-3p	CLIP-seq
MIRT2037768	hsa-miR-3173-5p	CLIP-seq
MIRT2037769	hsa-miR-3175	CLIP-seq
MIRT2267837	hsa-miR-324-3p	CLIP-seq
MIRT2267830	hsa-miR-3619-5p	CLIP-seq
MIRT2267838	hsa-miR-3667-3p	CLIP-seq
MIRT1132590	hsa-miR-3677-5p	CLIP-seq
MIRT1132599	hsa-miR-4290	CLIP-seq
MIRT1132601	hsa-miR-4313	CLIP-seq
MIRT1132607	hsa-miR-4523	CLIP-seq
MIRT1132628	hsa-miR-4779	CLIP-seq
MIRT1132633	hsa-miR-486-3p	CLIP-seq
MIRT2267839	hsa-miR-544b	CLIP-seq
MIRT2267834	hsa-miR-761	CLIP-seq
MIRT1132647	hsa-miR-922	CLIP-seq
MIRT2037800	hsa-miR-939	CLIP-seq
MIRT1132609	hsa-miR-4632	CLIP-seq
MIRT1132616	hsa-miR-4707-3p	CLIP-seq
MIRT1132595	hsa-miR-3943	CLIP-seq
MIRT1132599	hsa-miR-4290	CLIP-seq
MIRT1132601	hsa-miR-4313	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000287	Function	Magnesium ion binding	IDA	14976552
GO:0000422	Process	Autophagy of mitochondrion	NAS	24522549
GO:0001764	Process	Neuron migration	ISS
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10542369, 14976552, 16717194, 16775013, 16980613, 20194617
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS	24251416
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	8274451, 28386764
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	9730619, 24522549
GO:0005515	Function	Protein binding	IPI	14676191, 15161933, 15324659, 16306228, 16775013, 16959763, 16980613, 17442826, 17979178, 19553522, 19615732, 19966800, 20194617, 23902687, 24255178, 28514442, 32707033, 33961781, 35271311, 36931259
GO:0005524	Function	ATP binding	IDA	14976552
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23666762
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	NAS	24522549
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IDA	23902687
GO:0005886	Component	Plasma membrane	IDA	23902687
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	14976552
GO:0006468	Process	Protein phosphorylation	IMP	23666762
GO:0006468	Process	Protein phosphorylation	NAS	8274451
GO:0008289	Function	Lipid binding	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IDA	12429843
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	IMP	14976552
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016328	Component	Lateral plasma membrane	IDA	23902687
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030010	Process	Establishment of cell polarity	IDA	12429843
GO:0030010	Process	Establishment of cell polarity	TAS	16775013
GO:0030154	Process	Cell differentiation	IEA
GO:0030295	Function	Protein kinase activator activity	TAS	24522549
GO:0030425	Component	Dendrite	IDA	23666762
GO:0030425	Component	Dendrite	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	14976552
GO:0042995	Component	Cell projection	IEA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	IDA	15324659
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046777	Process	Protein autophosphorylation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	ISS	24251416
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	IBA
GO:0050321	Function	Tau-protein kinase activity	IMP	23666762
GO:0050321	Function	Tau-protein kinase activity	ISS	24251416
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050770	Process	Regulation of axonogenesis	IMP	20194617
GO:0051493	Process	Regulation of cytoskeleton organization	ISS
GO:0051646	Process	Mitochondrion localization	NAS	24522549
GO:0061564	Process	Axon development	ISS	16717194
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IDA	10542369
GO:0071963	Process	Establishment or maintenance of cell polarity regulating cell shape	ISS	16717194
GO:0097427	Component	Microtubule bundle	IDA	23902687
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902996	Process	Regulation of neurofibrillary tangle assembly	ISS	24251416

Other IDs

• MIM: 600526
• HGNC: 3332
• e!Ensembl: ENSG00000072518

Protein

• UniProt ID: Q7KZI7
• Protein name: Serine/threonine-protein kinase MARK2 (EC 2.7.11.1) (EC 2.7.11.26) (ELKL motif kinase 1) (EMK-1) (MAP/microtubule affinity-regulating kinase 2) (PAR1 homolog) (PAR1 homolog b) (Par-1b) (Par1b)
• Protein function: Serine/threonine-protein kinase (PubMed:23666762). Involved in cell polarity and microtubule dynamics regulation. Phosphorylates CRTC2/TORC2, DCX, HDAC7, KIF13B, MAP2, MAP4 and RAB11FIP2. Phosphorylates the microtubule-associated protein MAPT/TA
• PDB: 3IEC, 5EAK, 5KZ7, 5KZ8, 8TXY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	53 → 304	Protein kinase domain	Domain
  PF00627	UBA	324 → 360	UBA/TS-N domain	Domain
  PF02149	KA1	744 → 788	Kinase associated domain 1	Domain

• Tissue specificity: TISSUE SPECIFICITY: High levels of expression in heart, brain, skeletal muscle and pancreas, lower levels observed in lung, liver and kidney. {ECO:0000269|PubMed:9730619}.
• Sequence:

  MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIG
  KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
  TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
  LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
  YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
  DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
  LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS
  NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTST
  NRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHP
  NKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAG
  QLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPE
  SKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDA
  NSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIAS
  KIANELKL

• Sequence length: 788

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autism spectrum disorder	Pathogenic; Likely pathogenic	rs868032104, rs2539321295, rs2539322573, rs1940823816, rs2539326870, rs2539330444, rs2539332826, rs1941197590, rs2539306245, rs2539335503, rs2539336006, rs1252482376, rs1369701108, rs2539350226, rs2539350467, rs2539350502, rs2539350612, rs2539306253, rs2539306304, rs2539306378, rs2539313698, rs2539315343, rs2539319606	RCV004593554 RCV004593555 RCV004593557 RCV004593558 RCV004593559 RCV004593560 RCV004593561 RCV004593562 RCV004593563 RCV004593564 RCV004593566 RCV004593567 RCV004593568 RCV004593569 RCV004593570 RCV004593571 RCV004593572 RCV004593573 RCV004593574 RCV004593575 RCV004593576 RCV004593577 RCV004593578	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual developmental disorder, autosomal dominant 76	Pathogenic; Likely pathogenic	rs2539321295, rs2539350226, rs2539350467, rs2539306253, rs2539313698, rs2539315343	RCV005622270 RCV005622271 RCV005622272 RCV005622273 RCV005622274 RCV006254406	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual disability	Likely pathogenic	rs1252482376	RCV005410971	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant tumor of urinary bladder	Pathogenic	rs2539322573	RCV005933654	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MARK2-associated neurodevelopmental disorder	Likely pathogenic	rs2539336006	RCV005249702	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE COMPULSIVE BEHAVIOR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	28173772, 28187035		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11964083, 18366077, 31048498		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25163932		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21811019	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37901230	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30511258		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12589358		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30511258		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29378352		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	32066674	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28222093		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	35982159	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11287624		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28187035		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18386288		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	34953473	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	16091733		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11964083, 17695512, 24009311		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35743080	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12645337		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27878245		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28148395		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30718498		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25163932		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12645337		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12589358, 24973402		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12707033		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12707033		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23517743		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16194864		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10972534, 16194864		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16194864		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18626018	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31287960		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31287960		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28148395		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18005014		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	27714636		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	22993310		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	28670703		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22682129, 24790104, 26616854		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22682129, 24790104, 26616854		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	25163932		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28155585		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19060230, 23919450		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15158914	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27819671		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27819671		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12645337, 16003238, 17323377, 25353287, 28187035, 28758812, 28834900, 30383541		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	15563688		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25907283	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28173772		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28883515		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11964083, 17695512, 24009311		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27878245		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11964083, 24436106, 28182192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17373694, 19170048		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22993310		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11964083, 16091733, 19170048, 19941475, 22682129, 23517743		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12707033		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25163932		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15492257, 18315603		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21378407, 22009534		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	25505176		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28565918		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	23391721		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11395381, 11964083, 12645337, 16091733, 19424642, 21147226, 23517743, 24436106, 25163932, 27600331, 28173772, 29291033		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28222093		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28173772		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11964083, 23293110, 24436106, 28182192		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24436106		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16410750, 22238344, 30185553		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31175838		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28565918		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	28565918		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	20131237, 28883515		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	8755558, 8845846		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17373694, 19170048		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	19307611		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17532472, 23739922, 25689283		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23517743		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21905006		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16978587, 21049487		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	28957875		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28173772		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15625067		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30515700		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22993310		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35743080	Associate	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	LHGDN	17234589		★☆☆☆☆ Found in Text Mining only