Gene Gene information from NCBI Gene database.
Entrez ID 2010
Gene name Emerin
Gene symbol EMD
Synonyms (NCBI Gene)
EDMDLEMD5STA
Chromosome X
Chromosome location Xq28
Summary Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting f
SNPs SNP information provided by dbSNP.
54
SNP ID Visualize variation Clinical significance Consequence
rs104894805 C>A,T Pathogenic, uncertain-significance Coding sequence variant, missense variant
rs104894806 C>A Pathogenic Coding sequence variant, missense variant
rs132630262 C>T Pathogenic Coding sequence variant, stop gained, 5 prime UTR variant
rs137977232 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign-likely-benign Coding sequence variant, missense variant
rs139983160 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
7
miRTarBase ID miRNA Experiments Reference
MIRT022307 hsa-miR-124-3p Microarray 18668037
MIRT023624 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT050333 hsa-miR-25-3p CLASH 23622248
MIRT049830 hsa-miR-92a-3p CLASH 23622248
MIRT046034 hsa-miR-125b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
42
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IBA
GO:0003779 Function Actin binding IDA 15328537
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 11313760, 11587540, 12163176, 14597414, 15009215, 15328537, 15671068, 16169070, 16189514, 16858403, 17462627, 19323649, 19933576, 21346760, 21391237, 21610090, 22399800, 25416956, 25502805, 25910212, 27107012, 29568061, 30488537, 30833792, 31515488, 32296183, 32814053, 35271311
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300384 3331 ENSG00000102119
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P50402
Protein name Emerin
Protein function Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in
PDB 1JEI , 2ODC , 2ODG , 6GHD , 6RPR , 7NDY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03020 LEM 3 42 LEM domain Domain
Tissue specificity TISSUE SPECIFICITY: Skeletal muscle, heart, colon, testis, ovary and pancreas.
Sequence
MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYS
FSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQS
VTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLS
YYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF
FIYHFMQAEEGNPF
Sequence length 254
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytoskeleton in muscle cells
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
  Nuclear Envelope Breakdown
Initiation of Nuclear Envelope (NE) Reformation
Depolymerisation of the Nuclear Lamina
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
28
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Cardiovascular phenotype Pathogenic rs2522788283, rs876661345, rs132630262 RCV002432875
RCV000246169
RCV002381248
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Charcot-Marie-Tooth disease type 2 Likely pathogenic rs1557182214 RCV002221161
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EMD-related disorder Pathogenic rs782452523 RCV003401269
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Emery-Dreifuss muscular dystrophy Pathogenic; Likely pathogenic rs727503036, rs1557182301 RCV001280616
RCV001553580
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARDIOMYOPATHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Abnormal involuntary movement Abnormal Involuntary Movement BEFREE 30298296
★☆☆☆☆
Found in Text Mining only
Activated Protein C Resistance Activated Protein C Resistance BEFREE 9690807
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30542735
★☆☆☆☆
Found in Text Mining only
Aneuploidy Aneuploidy Pubtator 19581290 Associate
★☆☆☆☆
Found in Text Mining only
Antiphospholipid Syndrome Antiphospholipid Syndrome BEFREE 27331311
★☆☆☆☆
Found in Text Mining only
Arrhythmias Cardiac Cardiac arrhythmias Pubtator 36106556 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 27717524
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation BEFREE 18266676
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation LHGDN 18266676
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 18266676 Associate
★☆☆☆☆
Found in Text Mining only