Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	200916
Gene name	Ribosomal protein L22 like 1
Gene symbol	RPL22L1
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3q26.2

109

Show/Hide all (109)

miRTarBase ID	miRNA	Experiments	Reference
MIRT460062	hsa-miR-942-3p	PAR-CLIP	23592263
MIRT460061	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT460060	hsa-miR-6500-3p	PAR-CLIP	23592263
MIRT460059	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT460058	hsa-miR-4459	PAR-CLIP	23592263
MIRT460057	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT460056	hsa-miR-6849-3p	PAR-CLIP	23592263
MIRT460055	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT460054	hsa-miR-3926	PAR-CLIP	23592263
MIRT460053	hsa-miR-548s	PAR-CLIP	23592263
MIRT460052	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT460062	hsa-miR-942-3p	PAR-CLIP	23592263
MIRT460061	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT460060	hsa-miR-6500-3p	PAR-CLIP	23592263
MIRT460059	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT460058	hsa-miR-4459	PAR-CLIP	23592263
MIRT460057	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT460056	hsa-miR-6849-3p	PAR-CLIP	23592263
MIRT460055	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT460054	hsa-miR-3926	PAR-CLIP	23592263
MIRT460053	hsa-miR-548s	PAR-CLIP	23592263
MIRT460052	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT1316297	hsa-let-7a	CLIP-seq
MIRT1316298	hsa-let-7b	CLIP-seq
MIRT1316299	hsa-let-7c	CLIP-seq
MIRT1316300	hsa-let-7d	CLIP-seq
MIRT1316301	hsa-let-7e	CLIP-seq
MIRT1316302	hsa-let-7f	CLIP-seq
MIRT1316303	hsa-let-7g	CLIP-seq
MIRT1316304	hsa-let-7i	CLIP-seq
MIRT1316305	hsa-miR-1228	CLIP-seq
MIRT1316306	hsa-miR-1262	CLIP-seq
MIRT1316307	hsa-miR-1283	CLIP-seq
MIRT1316308	hsa-miR-202	CLIP-seq
MIRT1316309	hsa-miR-2052	CLIP-seq
MIRT1316310	hsa-miR-24	CLIP-seq
MIRT1316311	hsa-miR-25	CLIP-seq
MIRT1316312	hsa-miR-32	CLIP-seq
MIRT1316313	hsa-miR-342-3p	CLIP-seq
MIRT1316314	hsa-miR-3622b-5p	CLIP-seq
MIRT1316315	hsa-miR-363	CLIP-seq
MIRT1316316	hsa-miR-367	CLIP-seq
MIRT1316317	hsa-miR-4253	CLIP-seq
MIRT1316318	hsa-miR-4267	CLIP-seq
MIRT1316319	hsa-miR-4284	CLIP-seq
MIRT1316320	hsa-miR-4299	CLIP-seq
MIRT1316321	hsa-miR-4433	CLIP-seq
MIRT1316322	hsa-miR-4452	CLIP-seq
MIRT1316323	hsa-miR-4456	CLIP-seq
MIRT1316324	hsa-miR-4458	CLIP-seq
MIRT1316325	hsa-miR-4477a	CLIP-seq
MIRT1316326	hsa-miR-4488	CLIP-seq
MIRT1316327	hsa-miR-4496	CLIP-seq
MIRT1316328	hsa-miR-4500	CLIP-seq
MIRT1316329	hsa-miR-4678	CLIP-seq
MIRT1316330	hsa-miR-4693-3p	CLIP-seq
MIRT1316331	hsa-miR-4697-5p	CLIP-seq
MIRT1316332	hsa-miR-4701-3p	CLIP-seq
MIRT1316333	hsa-miR-4729	CLIP-seq
MIRT1316334	hsa-miR-4793-3p	CLIP-seq
MIRT1316335	hsa-miR-508-5p	CLIP-seq
MIRT1316336	hsa-miR-513a-3p	CLIP-seq
MIRT1316337	hsa-miR-520d-5p	CLIP-seq
MIRT1316338	hsa-miR-524-5p	CLIP-seq
MIRT1316339	hsa-miR-542-3p	CLIP-seq
MIRT1316340	hsa-miR-548ad	CLIP-seq
MIRT1316341	hsa-miR-548q	CLIP-seq
MIRT1316342	hsa-miR-578	CLIP-seq
MIRT1316343	hsa-miR-579	CLIP-seq
MIRT1316344	hsa-miR-651	CLIP-seq
MIRT1316345	hsa-miR-661	CLIP-seq
MIRT1316346	hsa-miR-766	CLIP-seq
MIRT1316347	hsa-miR-92a	CLIP-seq
MIRT1316348	hsa-miR-92b	CLIP-seq
MIRT1316349	hsa-miR-98	CLIP-seq
MIRT1316305	hsa-miR-1228	CLIP-seq
MIRT1316310	hsa-miR-24	CLIP-seq
MIRT1316313	hsa-miR-342-3p	CLIP-seq
MIRT1316314	hsa-miR-3622b-5p	CLIP-seq
MIRT1316317	hsa-miR-4253	CLIP-seq
MIRT1316319	hsa-miR-4284	CLIP-seq
MIRT2094026	hsa-miR-4476	CLIP-seq
MIRT1316306	hsa-miR-1262	CLIP-seq
MIRT2318571	hsa-miR-1343	CLIP-seq
MIRT2318572	hsa-miR-27a	CLIP-seq
MIRT2318573	hsa-miR-27b	CLIP-seq
MIRT2318574	hsa-miR-3065-3p	CLIP-seq
MIRT2318575	hsa-miR-3074-5p	CLIP-seq
MIRT2318576	hsa-miR-3122	CLIP-seq
MIRT2318577	hsa-miR-3132	CLIP-seq
MIRT2318578	hsa-miR-3194-3p	CLIP-seq
MIRT2318579	hsa-miR-323-5p	CLIP-seq
MIRT1316314	hsa-miR-3622b-5p	CLIP-seq
MIRT2318580	hsa-miR-3913-5p	CLIP-seq
MIRT1316317	hsa-miR-4253	CLIP-seq
MIRT1316332	hsa-miR-4701-3p	CLIP-seq
MIRT2318581	hsa-miR-4743	CLIP-seq
MIRT2318582	hsa-miR-4747-5p	CLIP-seq
MIRT1316334	hsa-miR-4793-3p	CLIP-seq
MIRT1316335	hsa-miR-508-5p	CLIP-seq
MIRT2318583	hsa-miR-513a-5p	CLIP-seq
MIRT1316339	hsa-miR-542-3p	CLIP-seq
MIRT1316345	hsa-miR-661	CLIP-seq
MIRT2318584	hsa-miR-671-5p	CLIP-seq
MIRT1316346	hsa-miR-766	CLIP-seq
MIRT2318585	hsa-miR-876-3p	CLIP-seq
MIRT1316318	hsa-miR-4267	CLIP-seq
MIRT2094026	hsa-miR-4476	CLIP-seq
MIRT1316344	hsa-miR-651	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IBA
GO:0003723	Function	RNA binding	IBA
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6P5R6

Protein name

Ribosomal protein eL22-like (60S ribosomal protein L22-like 1) (Large ribosomal subunit protein eL22-like 1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01776	Ribosomal_L22e	11 → 118	Ribosomal L22e protein family	Family

Sequence

MAPQKDRKPKRSTWRFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERF
KNKITVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESES
ED

Sequence length

122

Interactions

View interactions

	KEGG		Reactome
	Ribosome Coronavirus disease - COVID-19		L13a-mediated translational silencing of Ceruloplasmin expression SRP-dependent cotranslational protein targeting to membrane Viral mRNA Translation Major pathway of rRNA processing in the nucleolus and cytosol Formation of a pool of free 40S subunits GTP hydrolysis and joining of the 60S ribosomal subunit Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	39509434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39509434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33229623, 33456353, 33461173, 34002666, 34420511, 35513791, 35983409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26618703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31581233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35909892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36192632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37985768	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26618703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31089825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26618703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26618703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32707690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26618703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31089825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36625246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RPL22L1 (ribosomal protein L22 like 1)