Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	200728
Gene name	Transmembrane protein 17
Gene symbol	TMEM17
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2p15

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026578	hsa-miR-192-5p	Microarray	19074876
MIRT1432766	hsa-miR-1193	CLIP-seq
MIRT1432767	hsa-miR-1224-3p	CLIP-seq
MIRT1432768	hsa-miR-1228	CLIP-seq
MIRT1432769	hsa-miR-1307	CLIP-seq
MIRT1432770	hsa-miR-1343	CLIP-seq
MIRT1432771	hsa-miR-150	CLIP-seq
MIRT1432772	hsa-miR-1913	CLIP-seq
MIRT1432773	hsa-miR-1976	CLIP-seq
MIRT1432774	hsa-miR-2276	CLIP-seq
MIRT1432775	hsa-miR-2392	CLIP-seq
MIRT1432776	hsa-miR-3152-3p	CLIP-seq
MIRT1432777	hsa-miR-3182	CLIP-seq
MIRT1432778	hsa-miR-3194-3p	CLIP-seq
MIRT1432779	hsa-miR-324-3p	CLIP-seq
MIRT1432780	hsa-miR-377	CLIP-seq
MIRT1432781	hsa-miR-4256	CLIP-seq
MIRT1432782	hsa-miR-4279	CLIP-seq
MIRT1432783	hsa-miR-4284	CLIP-seq
MIRT1432784	hsa-miR-433	CLIP-seq
MIRT1432785	hsa-miR-4505	CLIP-seq
MIRT1432786	hsa-miR-4638-5p	CLIP-seq
MIRT1432787	hsa-miR-4662a-5p	CLIP-seq
MIRT1432788	hsa-miR-4676-5p	CLIP-seq
MIRT1432789	hsa-miR-4722-3p	CLIP-seq
MIRT1432790	hsa-miR-5096	CLIP-seq
MIRT1432791	hsa-miR-575	CLIP-seq
MIRT1432792	hsa-miR-629	CLIP-seq
MIRT2129729	hsa-miR-106a	CLIP-seq
MIRT2129730	hsa-miR-106b	CLIP-seq
MIRT1432767	hsa-miR-1224-3p	CLIP-seq
MIRT1432768	hsa-miR-1228	CLIP-seq
MIRT2129731	hsa-miR-1234	CLIP-seq
MIRT1432770	hsa-miR-1343	CLIP-seq
MIRT1432771	hsa-miR-150	CLIP-seq
MIRT2129732	hsa-miR-17	CLIP-seq
MIRT1432772	hsa-miR-1913	CLIP-seq
MIRT2129733	hsa-miR-20a	CLIP-seq
MIRT2129734	hsa-miR-20b	CLIP-seq
MIRT1432774	hsa-miR-2276	CLIP-seq
MIRT1432775	hsa-miR-2392	CLIP-seq
MIRT2129735	hsa-miR-302a	CLIP-seq
MIRT2129736	hsa-miR-302b	CLIP-seq
MIRT2129737	hsa-miR-302c	CLIP-seq
MIRT2129738	hsa-miR-302d	CLIP-seq
MIRT2129739	hsa-miR-302e	CLIP-seq
MIRT1432777	hsa-miR-3182	CLIP-seq
MIRT1432778	hsa-miR-3194-3p	CLIP-seq
MIRT1432779	hsa-miR-324-3p	CLIP-seq
MIRT2129740	hsa-miR-372	CLIP-seq
MIRT2129741	hsa-miR-373	CLIP-seq
MIRT1432780	hsa-miR-377	CLIP-seq
MIRT1432781	hsa-miR-4256	CLIP-seq
MIRT1432783	hsa-miR-4284	CLIP-seq
MIRT1432784	hsa-miR-433	CLIP-seq
MIRT2129742	hsa-miR-4438	CLIP-seq
MIRT2129743	hsa-miR-4534	CLIP-seq
MIRT1432786	hsa-miR-4638-5p	CLIP-seq
MIRT2129744	hsa-miR-4731-5p	CLIP-seq
MIRT2129745	hsa-miR-5095	CLIP-seq
MIRT2129746	hsa-miR-512-3p	CLIP-seq
MIRT2129747	hsa-miR-519d	CLIP-seq
MIRT2129748	hsa-miR-520a-3p	CLIP-seq
MIRT2129749	hsa-miR-520b	CLIP-seq
MIRT2129750	hsa-miR-520c-3p	CLIP-seq
MIRT2129751	hsa-miR-520d-3p	CLIP-seq
MIRT2129752	hsa-miR-520e	CLIP-seq
MIRT2129753	hsa-miR-520g	CLIP-seq
MIRT2129754	hsa-miR-520h	CLIP-seq
MIRT2129755	hsa-miR-93	CLIP-seq
MIRT1432768	hsa-miR-1228	CLIP-seq
MIRT1432769	hsa-miR-1307	CLIP-seq
MIRT1432770	hsa-miR-1343	CLIP-seq
MIRT1432771	hsa-miR-150	CLIP-seq
MIRT1432773	hsa-miR-1976	CLIP-seq
MIRT1432774	hsa-miR-2276	CLIP-seq
MIRT1432775	hsa-miR-2392	CLIP-seq
MIRT1432778	hsa-miR-3194-3p	CLIP-seq
MIRT2351219	hsa-miR-3199	CLIP-seq
MIRT1432780	hsa-miR-377	CLIP-seq
MIRT1432782	hsa-miR-4279	CLIP-seq
MIRT1432783	hsa-miR-4284	CLIP-seq
MIRT2129743	hsa-miR-4534	CLIP-seq
MIRT1432786	hsa-miR-4638-5p	CLIP-seq
MIRT2351220	hsa-miR-4695-3p	CLIP-seq
MIRT1432789	hsa-miR-4722-3p	CLIP-seq
MIRT2351221	hsa-miR-552	CLIP-seq
MIRT2351222	hsa-miR-562	CLIP-seq
MIRT2129729	hsa-miR-106a	CLIP-seq
MIRT2129730	hsa-miR-106b	CLIP-seq
MIRT1432767	hsa-miR-1224-3p	CLIP-seq
MIRT2129731	hsa-miR-1234	CLIP-seq
MIRT1432771	hsa-miR-150	CLIP-seq
MIRT2129732	hsa-miR-17	CLIP-seq
MIRT1432772	hsa-miR-1913	CLIP-seq
MIRT2129733	hsa-miR-20a	CLIP-seq
MIRT2129734	hsa-miR-20b	CLIP-seq
MIRT2129735	hsa-miR-302a	CLIP-seq
MIRT2129736	hsa-miR-302b	CLIP-seq
MIRT2129737	hsa-miR-302c	CLIP-seq
MIRT2129738	hsa-miR-302d	CLIP-seq
MIRT2129739	hsa-miR-302e	CLIP-seq
MIRT1432777	hsa-miR-3182	CLIP-seq
MIRT1432779	hsa-miR-324-3p	CLIP-seq
MIRT2395970	hsa-miR-3685	CLIP-seq
MIRT2129740	hsa-miR-372	CLIP-seq
MIRT2129741	hsa-miR-373	CLIP-seq
MIRT2395971	hsa-miR-384	CLIP-seq
MIRT1432781	hsa-miR-4256	CLIP-seq
MIRT1432784	hsa-miR-433	CLIP-seq
MIRT2129744	hsa-miR-4731-5p	CLIP-seq
MIRT2129746	hsa-miR-512-3p	CLIP-seq
MIRT2129747	hsa-miR-519d	CLIP-seq
MIRT2129748	hsa-miR-520a-3p	CLIP-seq
MIRT2129749	hsa-miR-520b	CLIP-seq
MIRT2129750	hsa-miR-520c-3p	CLIP-seq
MIRT2129751	hsa-miR-520d-3p	CLIP-seq
MIRT2129752	hsa-miR-520e	CLIP-seq
MIRT2129753	hsa-miR-520g	CLIP-seq
MIRT2129754	hsa-miR-520h	CLIP-seq
MIRT2129755	hsa-miR-93	CLIP-seq
MIRT2644850	hsa-miR-4735-5p	CLIP-seq
MIRT2644851	hsa-miR-4775	CLIP-seq
MIRT2644852	hsa-miR-590-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	26638075, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	ISS
GO:0016020	Component	Membrane	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0035869	Component	Ciliary transition zone	IBA
GO:0035869	Component	Ciliary transition zone	IEA
GO:0035869	Component	Ciliary transition zone	ISS
GO:0036038	Component	MKS complex	IEA
GO:0036038	Component	MKS complex	ISS
GO:0042995	Component	Cell projection	IEA
GO:0060170	Component	Ciliary membrane	IEA
GO:0060170	Component	Ciliary membrane	ISS
GO:0060271	Process	Cilium assembly	IEA
GO:0060271	Process	Cilium assembly	ISS
GO:1905515	Process	Non-motile cilium assembly	IBA
GO:1905515	Process	Non-motile cilium assembly	IMP	26982032

MIM	HGNC	e!Ensembl
614950	26623	ENSG00000186889

Q86X19

Protein name

Transmembrane protein 17

Protein function

Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for cili

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09799	Transmemb_17	45 → 151	Predicted membrane protein	Family

Sequence

MELPDPVRQRLGNFSRAVFSDSNRTGPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVS
SIMMLHMKYSILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLL
QLPLILFLLFNEGLTNLPLEKAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDR
LSANRGDMRRMRSCIEEI

Sequence length

198

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL APLASIA OF THE VERMIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL STROMAL TUMORS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Joubert syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meckel-Gruber syndrome	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Orofaciodigital syndrome I	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	30122991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29050311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	32055034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	39206901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30122991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29050311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31562322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30122991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30122991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29050311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31562322		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31562322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30122991		★★★★★ ★☆☆☆☆ Found in Text Mining only

TMEM17 (transmembrane protein 17)