GKN2 (gastrokine 2)

Gene

• Entrez ID: 200504
• Gene name: Gastrokine 2
• Gene symbol: GKN2
• Synonyms (NCBI Gene): BRICD1B, GDDR, PRO813, TFIZ1, VLTI465
• Chromosome: 2
• Chromosome location: 2p13.3
• Summary: The secretory protein encoded by this gene is produced in gastric surface mucous cells, where it can bind trefoil factor family peptide 1 or gastrokine-1. This gene may be a tumor suppressor gene, as its expression is markedly decreased in gastric cancer

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1020312	hsa-miR-1256	CLIP-seq
MIRT1020313	hsa-miR-3153	CLIP-seq
MIRT1020314	hsa-miR-371b-5p	CLIP-seq
MIRT1020315	hsa-miR-4259	CLIP-seq
MIRT1020316	hsa-miR-4260	CLIP-seq
MIRT1020317	hsa-miR-4668-5p	CLIP-seq
MIRT1020318	hsa-miR-4698	CLIP-seq
MIRT1020319	hsa-miR-4715-5p	CLIP-seq
MIRT1020320	hsa-miR-486-3p	CLIP-seq
MIRT1020312	hsa-miR-1256	CLIP-seq
MIRT1020313	hsa-miR-3153	CLIP-seq
MIRT1549248	hsa-miR-371-5p	CLIP-seq
MIRT1020314	hsa-miR-371b-5p	CLIP-seq
MIRT1020315	hsa-miR-4259	CLIP-seq
MIRT1020316	hsa-miR-4260	CLIP-seq
MIRT1020317	hsa-miR-4668-5p	CLIP-seq
MIRT1020318	hsa-miR-4698	CLIP-seq
MIRT1020319	hsa-miR-4715-5p	CLIP-seq
MIRT1020320	hsa-miR-486-3p	CLIP-seq
MIRT1020312	hsa-miR-1256	CLIP-seq
MIRT1020313	hsa-miR-3153	CLIP-seq
MIRT1020314	hsa-miR-371b-5p	CLIP-seq
MIRT1020315	hsa-miR-4259	CLIP-seq
MIRT1020316	hsa-miR-4260	CLIP-seq
MIRT1020317	hsa-miR-4668-5p	CLIP-seq
MIRT1020318	hsa-miR-4698	CLIP-seq
MIRT1020319	hsa-miR-4715-5p	CLIP-seq
MIRT1020320	hsa-miR-486-3p	CLIP-seq
MIRT1020312	hsa-miR-1256	CLIP-seq
MIRT1549248	hsa-miR-371-5p	CLIP-seq
MIRT1020314	hsa-miR-371b-5p	CLIP-seq
MIRT1020315	hsa-miR-4259	CLIP-seq
MIRT1020316	hsa-miR-4260	CLIP-seq
MIRT1020318	hsa-miR-4698	CLIP-seq
MIRT1020319	hsa-miR-4715-5p	CLIP-seq
MIRT1020320	hsa-miR-486-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Repression	17595528
RELA	Repression	17595528

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002283	Process	Neutrophil activation involved in immune response	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0010467	Process	Gene expression	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0044546	Process	NLRP3 inflammasome complex assembly	IEA
GO:0045178	Component	Basal part of cell	IEA
GO:0051414	Process	Response to cortisol	IEA

Other IDs

• MIM: 618589
• HGNC: 24588
• e!Ensembl: ENSG00000183607

Protein

• UniProt ID: Q86XP6
• Protein name: Gastrokine-2 (Blottin) (Down-regulated in gastric cancer) (Trefoil factor interactions(z) 1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04089	BRICHOS	56 → 150	BRICHOS domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in gastric mucosa. {ECO:0000269|PubMed:15924415}.
• Sequence:

  MKILVAFLVVLTIFGIQSHGYEVFNIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSS
  TTIFDYKHGYIASRVLSRRACFILKMDHQNIPPLNNLQWYIYEKQALDNMFSSKYTWVKY
  NPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENTHNVGAGGCAKAGLLGILGISICA
  DIHV

• Sequence length: 184

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BENIGN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	18593995		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31558162		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28150071	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37442189	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	18593995	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	29493231		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19437484		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18722547, 21870107, 24408014, 25270871, 26842925, 26974160, 28150071, 31382983		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24408014, 31382983		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	9512120		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1333557, 18722547, 21870107, 24408014, 25270871, 26070363, 26842925, 31293645, 31382983		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19437484		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18722547, 21870107, 24408014, 25270871, 26842925, 26974160, 28150071, 31382983		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18593995, 18722547, 24460791, 27323966, 28150071, 31463974	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25270871	Inhibit	★☆☆☆☆ Found in Text Mining only