Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	200312
Gene name	Ring finger protein 215
Gene symbol	RNF215
Synonyms (NCBI Gene)	-
Chromosome	22
Chromosome location	22q12.2

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046666	hsa-miR-222-3p	CLASH	23622248
MIRT1312153	hsa-miR-1255a	CLIP-seq
MIRT1312154	hsa-miR-1255b	CLIP-seq
MIRT1312155	hsa-miR-1827	CLIP-seq
MIRT1312156	hsa-miR-1914	CLIP-seq
MIRT1312157	hsa-miR-2467-3p	CLIP-seq
MIRT1312158	hsa-miR-3173-3p	CLIP-seq
MIRT1312159	hsa-miR-3180-5p	CLIP-seq
MIRT1312160	hsa-miR-331-3p	CLIP-seq
MIRT1312161	hsa-miR-3616-3p	CLIP-seq
MIRT1312162	hsa-miR-3678-3p	CLIP-seq
MIRT1312163	hsa-miR-3919	CLIP-seq
MIRT1312164	hsa-miR-4263	CLIP-seq
MIRT1312165	hsa-miR-4428	CLIP-seq
MIRT1312166	hsa-miR-4436b-3p	CLIP-seq
MIRT1312167	hsa-miR-4700-3p	CLIP-seq
MIRT1312168	hsa-miR-4749-3p	CLIP-seq
MIRT1312169	hsa-miR-4771	CLIP-seq
MIRT1312170	hsa-miR-4773	CLIP-seq
MIRT1312171	hsa-miR-4779	CLIP-seq
MIRT1312172	hsa-miR-4783-3p	CLIP-seq
MIRT1312173	hsa-miR-4798-3p	CLIP-seq
MIRT1312174	hsa-miR-493	CLIP-seq
MIRT1312175	hsa-miR-513a-5p	CLIP-seq
MIRT1312176	hsa-miR-520a-5p	CLIP-seq
MIRT1312177	hsa-miR-525-5p	CLIP-seq
MIRT1312178	hsa-miR-545	CLIP-seq
MIRT1312179	hsa-miR-576-5p	CLIP-seq
MIRT1312180	hsa-miR-640	CLIP-seq
MIRT2092782	hsa-miR-199a-5p	CLIP-seq
MIRT2092783	hsa-miR-199b-5p	CLIP-seq
MIRT2092784	hsa-miR-3667-3p	CLIP-seq
MIRT2092785	hsa-miR-4302	CLIP-seq
MIRT2092786	hsa-miR-4667-3p	CLIP-seq
MIRT2317354	hsa-miR-127-5p	CLIP-seq
MIRT2092782	hsa-miR-199a-5p	CLIP-seq
MIRT2092783	hsa-miR-199b-5p	CLIP-seq
MIRT2317355	hsa-miR-3151	CLIP-seq
MIRT2317356	hsa-miR-3202	CLIP-seq
MIRT2092784	hsa-miR-3667-3p	CLIP-seq
MIRT2317357	hsa-miR-4264	CLIP-seq
MIRT2317358	hsa-miR-4290	CLIP-seq
MIRT2092785	hsa-miR-4302	CLIP-seq
MIRT2317359	hsa-miR-4447	CLIP-seq
MIRT2317360	hsa-miR-4472	CLIP-seq
MIRT2317361	hsa-miR-4476	CLIP-seq
MIRT2092786	hsa-miR-4667-3p	CLIP-seq
MIRT2317362	hsa-miR-491-5p	CLIP-seq
MIRT2317363	hsa-miR-622	CLIP-seq
MIRT2092782	hsa-miR-199a-5p	CLIP-seq
MIRT2092783	hsa-miR-199b-5p	CLIP-seq
MIRT2317355	hsa-miR-3151	CLIP-seq
MIRT2092784	hsa-miR-3667-3p	CLIP-seq
MIRT2458451	hsa-miR-3911	CLIP-seq
MIRT2317358	hsa-miR-4290	CLIP-seq
MIRT2092785	hsa-miR-4302	CLIP-seq
MIRT2317359	hsa-miR-4447	CLIP-seq
MIRT2317360	hsa-miR-4472	CLIP-seq
MIRT2092786	hsa-miR-4667-3p	CLIP-seq
MIRT2317362	hsa-miR-491-5p	CLIP-seq
MIRT2613218	hsa-miR-1324	CLIP-seq
MIRT2613219	hsa-miR-1972	CLIP-seq
MIRT2613220	hsa-miR-361-3p	CLIP-seq
MIRT2613221	hsa-miR-4717-5p	CLIP-seq
MIRT2613218	hsa-miR-1324	CLIP-seq
MIRT2613219	hsa-miR-1972	CLIP-seq
MIRT2613220	hsa-miR-361-3p	CLIP-seq
MIRT2613221	hsa-miR-4717-5p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9Y6U7

Protein name

RING finger protein 215

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13639	zf-RING_2	323 → 366	Ring finger domain	Domain

Sequence

MGPAARPALRSPPPPPPPPPSPLLLLLPLLPLWLGLAGPGAAADGSEPAAGAGRGGARAV
RVDVRLPRQDALVLEGVRIGSEADPAPLLGGRLLLMDIVDAEQEAPVEGWIAVAYVGKEQ
AAQFHQENKGSGPQAYPKALVQQMRRALFLGASALLLLILNHNVVRELDISQLLLRPVIV
LHYSSNVTKLLDALLQRTQATAEITSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCL
GGSRAQEQKPLQQLWNAILLVAMLLCTGLVVQAQRQASRQSQRELGGQVDLFKRRVVRRL
ASLKTRRCRLSRAAQGLPDPGAETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLMLQQ
TCPLCKFNVLGNRYSDD

Sequence length

377

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune disease	Pubtator	36426941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36426941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF215 (ring finger protein 215)