Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	200186
Gene name	CREB regulated transcription coactivator 2
Gene symbol	CRTC2
Synonyms (NCBI Gene)	TORC-2TORC2
Chromosome	1
Chromosome location	1q21.3
Summary	This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and th

155

Show/Hide all (155)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049460	hsa-miR-92a-3p	CLASH	23622248
MIRT059676	hsa-miR-1321	PAR-CLIP	23592263
MIRT059680	hsa-miR-4739	PAR-CLIP	23592263
MIRT059681	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT478795	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT478794	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT478793	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT478792	hsa-miR-4722-3p	PAR-CLIP	23592263
MIRT478790	hsa-miR-6727-3p	PAR-CLIP	23592263
MIRT478791	hsa-miR-7515	PAR-CLIP	23592263
MIRT478789	hsa-miR-4790-3p	PAR-CLIP	23592263
MIRT478788	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT478787	hsa-miR-3202	PAR-CLIP	23592263
MIRT478786	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT478785	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT478784	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT478783	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT478782	hsa-miR-4271	PAR-CLIP	23592263
MIRT478781	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT478779	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT478780	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT478778	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT478777	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT478776	hsa-miR-5006-5p	PAR-CLIP	23592263
MIRT059676	hsa-miR-1321	PAR-CLIP	23592263
MIRT059680	hsa-miR-4739	PAR-CLIP	23592263
MIRT059681	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT478795	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT478794	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT478793	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT478792	hsa-miR-4722-3p	PAR-CLIP	23592263
MIRT478790	hsa-miR-6727-3p	PAR-CLIP	23592263
MIRT478791	hsa-miR-7515	PAR-CLIP	23592263
MIRT478789	hsa-miR-4790-3p	PAR-CLIP	23592263
MIRT478788	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT478787	hsa-miR-3202	PAR-CLIP	23592263
MIRT478786	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT478785	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT478784	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT478783	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT478782	hsa-miR-4271	PAR-CLIP	23592263
MIRT478781	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT478779	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT478780	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT478778	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT478777	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT478776	hsa-miR-5006-5p	PAR-CLIP	23592263
MIRT910823	hsa-miR-1193	CLIP-seq
MIRT910824	hsa-miR-1275	CLIP-seq
MIRT910825	hsa-miR-1295	CLIP-seq
MIRT910826	hsa-miR-1324	CLIP-seq
MIRT910827	hsa-miR-2115	CLIP-seq
MIRT910828	hsa-miR-302a	CLIP-seq
MIRT910829	hsa-miR-302b	CLIP-seq
MIRT910830	hsa-miR-302c	CLIP-seq
MIRT910831	hsa-miR-302d	CLIP-seq
MIRT910832	hsa-miR-302e	CLIP-seq
MIRT910833	hsa-miR-3155	CLIP-seq
MIRT910834	hsa-miR-3155b	CLIP-seq
MIRT910835	hsa-miR-3160-5p	CLIP-seq
MIRT910836	hsa-miR-3173-5p	CLIP-seq
MIRT910837	hsa-miR-323-5p	CLIP-seq
MIRT910838	hsa-miR-3675-5p	CLIP-seq
MIRT910839	hsa-miR-372	CLIP-seq
MIRT910840	hsa-miR-373	CLIP-seq
MIRT910841	hsa-miR-3973	CLIP-seq
MIRT910842	hsa-miR-4256	CLIP-seq
MIRT910843	hsa-miR-4438	CLIP-seq
MIRT910844	hsa-miR-4447	CLIP-seq
MIRT910845	hsa-miR-4472	CLIP-seq
MIRT910846	hsa-miR-4525	CLIP-seq
MIRT910847	hsa-miR-4665-5p	CLIP-seq
MIRT910848	hsa-miR-4685-5p	CLIP-seq
MIRT910849	hsa-miR-4723-5p	CLIP-seq
MIRT910850	hsa-miR-4747-3p	CLIP-seq
MIRT910851	hsa-miR-484	CLIP-seq
MIRT910852	hsa-miR-516a-3p	CLIP-seq
MIRT910853	hsa-miR-520a-3p	CLIP-seq
MIRT910854	hsa-miR-520b	CLIP-seq
MIRT910855	hsa-miR-520c-3p	CLIP-seq
MIRT910856	hsa-miR-520d-3p	CLIP-seq
MIRT910857	hsa-miR-520e	CLIP-seq
MIRT910858	hsa-miR-520f	CLIP-seq
MIRT910859	hsa-miR-520g	CLIP-seq
MIRT910860	hsa-miR-520h	CLIP-seq
MIRT910861	hsa-miR-541	CLIP-seq
MIRT910862	hsa-miR-625	CLIP-seq
MIRT910863	hsa-miR-654-5p	CLIP-seq
MIRT910864	hsa-miR-760	CLIP-seq
MIRT1970045	hsa-miR-1298	CLIP-seq
MIRT1970046	hsa-miR-205	CLIP-seq
MIRT1970047	hsa-miR-4642	CLIP-seq
MIRT910825	hsa-miR-1295	CLIP-seq
MIRT910826	hsa-miR-1324	CLIP-seq
MIRT910828	hsa-miR-302a	CLIP-seq
MIRT910829	hsa-miR-302b	CLIP-seq
MIRT910830	hsa-miR-302c	CLIP-seq
MIRT910831	hsa-miR-302d	CLIP-seq
MIRT910832	hsa-miR-302e	CLIP-seq
MIRT910833	hsa-miR-3155	CLIP-seq
MIRT910834	hsa-miR-3155b	CLIP-seq
MIRT910839	hsa-miR-372	CLIP-seq
MIRT910840	hsa-miR-373	CLIP-seq
MIRT910841	hsa-miR-3973	CLIP-seq
MIRT910842	hsa-miR-4256	CLIP-seq
MIRT910843	hsa-miR-4438	CLIP-seq
MIRT910850	hsa-miR-4747-3p	CLIP-seq
MIRT910851	hsa-miR-484	CLIP-seq
MIRT910853	hsa-miR-520a-3p	CLIP-seq
MIRT910854	hsa-miR-520b	CLIP-seq
MIRT910855	hsa-miR-520c-3p	CLIP-seq
MIRT910856	hsa-miR-520d-3p	CLIP-seq
MIRT910857	hsa-miR-520e	CLIP-seq
MIRT910858	hsa-miR-520f	CLIP-seq
MIRT910859	hsa-miR-520g	CLIP-seq
MIRT910860	hsa-miR-520h	CLIP-seq
MIRT910864	hsa-miR-760	CLIP-seq
MIRT910825	hsa-miR-1295	CLIP-seq
MIRT910826	hsa-miR-1324	CLIP-seq
MIRT910827	hsa-miR-2115	CLIP-seq
MIRT910828	hsa-miR-302a	CLIP-seq
MIRT910829	hsa-miR-302b	CLIP-seq
MIRT910830	hsa-miR-302c	CLIP-seq
MIRT910831	hsa-miR-302d	CLIP-seq
MIRT910832	hsa-miR-302e	CLIP-seq
MIRT910833	hsa-miR-3155	CLIP-seq
MIRT910834	hsa-miR-3155b	CLIP-seq
MIRT910835	hsa-miR-3160-5p	CLIP-seq
MIRT910836	hsa-miR-3173-5p	CLIP-seq
MIRT910839	hsa-miR-372	CLIP-seq
MIRT910840	hsa-miR-373	CLIP-seq
MIRT910841	hsa-miR-3973	CLIP-seq
MIRT910842	hsa-miR-4256	CLIP-seq
MIRT910843	hsa-miR-4438	CLIP-seq
MIRT910848	hsa-miR-4685-5p	CLIP-seq
MIRT910851	hsa-miR-484	CLIP-seq
MIRT910852	hsa-miR-516a-3p	CLIP-seq
MIRT910853	hsa-miR-520a-3p	CLIP-seq
MIRT910854	hsa-miR-520b	CLIP-seq
MIRT910855	hsa-miR-520c-3p	CLIP-seq
MIRT910856	hsa-miR-520d-3p	CLIP-seq
MIRT910857	hsa-miR-520e	CLIP-seq
MIRT910858	hsa-miR-520f	CLIP-seq
MIRT910859	hsa-miR-520g	CLIP-seq
MIRT910860	hsa-miR-520h	CLIP-seq
MIRT910864	hsa-miR-760	CLIP-seq
MIRT910827	hsa-miR-2115	CLIP-seq
MIRT910833	hsa-miR-3155	CLIP-seq
MIRT910834	hsa-miR-3155b	CLIP-seq
MIRT910835	hsa-miR-3160-5p	CLIP-seq
MIRT910836	hsa-miR-3173-5p	CLIP-seq
MIRT910843	hsa-miR-4438	CLIP-seq
MIRT910848	hsa-miR-4685-5p	CLIP-seq
MIRT910851	hsa-miR-484	CLIP-seq
MIRT910852	hsa-miR-516a-3p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0005515	Function	Protein binding	IPI	15454081, 18077367, 19164291, 19543265, 24255178, 32296183, 33961781, 35271311, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006094	Process	Gluconeogenesis	ISS
GO:0008140	Function	CAMP response element binding protein binding	IBA
GO:0008140	Function	CAMP response element binding protein binding	IEA
GO:0032793	Process	Positive regulation of CREB transcription factor activity	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051289	Process	Protein homotetramerization	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071320	Process	Cellular response to cAMP	IBA

MIM	HGNC	e!Ensembl
608972	27301	ENSG00000160741

Q53ET0

Protein name

CREB-regulated transcription coactivator 2 (Transducer of regulated cAMP response element-binding protein 2) (TORC-2) (Transducer of CREB protein 2)

Protein function

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts indep

PDB

4HTM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12884	TORC_N	18 → 75	Transducer of regulated CREB activity, N terminus	Family
PF12885	TORC_M	168 → 322	Transducer of regulated CREB activity middle domain	Family
PF12886	TORC_C	615 → 692	Transducer of regulated CREB activity, C terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Most abundantly expressed in the thymus. Present in both B and T-lymphocytes. Highly expressed in HEK293T cells and in insulinomas. High levels also in spleen, ovary, muscle and lung, with highest levels in muscle. Lower levels found i

Sequence

MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRR
YTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVM
NPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSS
RPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPS
LSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQ
PQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPAST
PGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTD
QRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPS
GHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTF
NHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRM
EPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ

Sequence length

693

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway AMPK signaling pathway Glucagon signaling pathway Insulin resistance Human T-cell leukemia virus 1 infection		Transcriptional activation of mitochondrial biogenesis Circadian Clock

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	24484648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26031354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	30682771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19509226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20010869, 24484648, 29105369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33000695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17805301, 30260029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35454338	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17805301, 30260029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16148943, 17950019, 28816409, 30825078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31385336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31233505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23459592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23459592, 31640252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16148943, 31233505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	26644205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27777238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24484648, 25256670, 29105369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24683191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26004186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26004186	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19509226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20010869, 24484648, 29105369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30838340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22184110, 27780891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18831768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26644205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31654553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26644205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26644205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28167137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20686120, 22045983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26031354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	22319435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18831768, 26004186, 26438156, 29156676, 30504425, 31355336		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEPHRONOPHTHISIS 2	Nephronophthisis	BEFREE	28978526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	29078378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25256670, 29105369, 31355336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19509226, 31454784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26644205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	18831768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30838340		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18776922, 18831768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23272152, 30838340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	30282812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SHORT syndrome	SHORT Syndrome	BEFREE	28934384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24484648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31233505		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26004186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26676751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24054871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CRTC2 (CREB regulated transcription coactivator 2)