NUDT17 (nudix hydrolase 17)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID 200035
Gene name Nudix hydrolase 17
Gene symbol NUDT17
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1q21.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0005777 Component Peroxisome IBA
GO:0006742 Process NADP+ catabolic process IBA
GO:0016787 Function Hydrolase activity IEA
GO:0019674 Process NAD+ metabolic process IBA
GO:0019677 Process NAD+ catabolic process IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C025
Protein name m7GpppN-mRNA hydrolase NUDT17 (EC 3.6.1.62) (Nucleoside diphosphate-linked moiety X motif 17) (Nudix motif 17)
Protein function Acts as a decapping enzyme capable of hydrolyzing monomethylated capped RNAs (in vitro). Hydrolyzes monomethylated capped RNA after alpha and beta phosphates to form N(7)-methyl-GDP. Shows low activity towards unmethylated capped RNA. {ECO:00002
PDB 5LF8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00293 NUDIX 90 → 234 NUDIX domain Domain
Sequence 
MAEVRVQLLLSRRPESVSFARSVCGLLGAGPGLGTWPIHCSLKRGRLVLSSRPFPGASAR
LPLQRPPFCPFAALEERPRVPGAELPTDRGVDLGVAVILQSSDKTVLLTRRARTLSVSPN
LWVPPGGHVELEEELLDGGLRELWEESGLHLPQGQFSWVPLGLWESAYPPRLSWGLPKYH
HIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPDVAAAVAAAEDGTETPGLLPQDLP
PSVLAVELEEDGRARPLVLHMSTLLRMIPTMAEDKERVSTGTKFALKLWLQHLGRTPPPC
KSAAYLDPGPAKEEWNMDPLPPNQGSGK
Sequence length 328
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST NEOPLASMS — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (9)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis, Gouty Gouty arthritis GWASDB_DG 23263486
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma CTD_human_DG 29915430
★★★★★
★☆☆☆☆
Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma Renal Carcinoma BEFREE 29113256
★★★★★
★☆☆☆☆
Found in Text Mining only
Gout Gout GWASDB_DG 23263486
★★★★★
★☆☆☆☆
Found in Text Mining only
Gout Gout Pubtator 36221101 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer CTD_human_DG 29915430
★★★★★
★☆☆☆☆
Found in Text Mining only
Mammary Carcinoma, Human Marfan Syndrome CTD_human_DG 29915430
★★★★★
★☆☆☆☆
Found in Text Mining only
Mammary Neoplasms Mammary Neoplasms CTD_human_DG 29915430
★★★★★
★☆☆☆☆
Found in Text Mining only
Mammary Neoplasms, Human Mammary Neoplasms CTD_human_DG 29915430
★★★★★
★☆☆☆☆
Found in Text Mining only