SLC5A9 (solute carrier family 5 member 9)

Gene

• Entrez ID: 200010
• Gene name: Solute carrier family 5 member 9
• Gene symbol: SLC5A9
• Synonyms (NCBI Gene): SGLT4
• Chromosome: 1
• Chromosome location: 1p33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1365845	hsa-miR-128	CLIP-seq
MIRT1365846	hsa-miR-1343	CLIP-seq
MIRT1365847	hsa-miR-1915	CLIP-seq
MIRT1365848	hsa-miR-1976	CLIP-seq
MIRT1365849	hsa-miR-3065-5p	CLIP-seq
MIRT1365850	hsa-miR-3117-3p	CLIP-seq
MIRT1365851	hsa-miR-3169	CLIP-seq
MIRT1365852	hsa-miR-4269	CLIP-seq
MIRT1365853	hsa-miR-4311	CLIP-seq
MIRT1365854	hsa-miR-4726-3p	CLIP-seq
MIRT1365855	hsa-miR-4759	CLIP-seq
MIRT1365856	hsa-miR-4760-3p	CLIP-seq
MIRT1365857	hsa-miR-555	CLIP-seq
MIRT2332252	hsa-miR-513c	CLIP-seq
MIRT2332253	hsa-miR-514b-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005362	Function	Low-affinity D-glucose:sodium symporter activity	TAS
GO:0005402	Function	Carbohydrate:monoatomic cation symporter activity	IEA
GO:0005412	Function	D-glucose:sodium symporter activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0015149	Function	Hexose transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015370	Function	Solute:sodium symporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 620216
• HGNC: 22146
• e!Ensembl: ENSG00000117834

Protein

• UniProt ID: Q2M3M2
• Protein name: Sodium/glucose cotransporter 4 (Na(+)/glucose cotransporter 4) (hSGLT4) (Solute carrier family 5 member 9)
• Protein function: Electrogenic Na(+)-coupled sugar symporter that may play a primary role in D-mannose and possibly D-fructose and D-glucose transport at the plasma membrane. Transporter activity is driven by a transmembrane Na(+) electrochemical gradient set by
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00474	SSF	67 → 496	Sodium:solute symporter family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the small intestine, kidney and liver. {ECO:0000269|PubMed:15607332}.
• Sequence:

  MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIAVGIWSSIRAS
  RGTIGGYFLAGRSMSWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATWLLLA
  LGWVFVPVYIAAGVVTMPQYLKKRFGGQRIQVYMSVLSLILYIFTKISTDIFSGALFIQM
  ALGWNLYLSTGILLVVTAVYTIAGGLMAVIYTDALQTVIMVGGALVLMFLGFQDVGWYPG
  LEQRYRQAIPNVTVPNTTCHLPRPDAFHILRDPVSGDIPWPGLIFGLTVLATWCWCTDQV
  IVQRSLSAKSLSHAKGGSVLGGYLKILPMFFIVMPGMISRALFPDEVGCVDPDVCQRICG
  ARVGCSNIAYPKLVMALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFTIDVWQRFRRK
  STEQELMVVGRVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIF
  CKRVTEPGAFWGLVFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGL
  TAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHESTPEISERPAGECPAGGGA
  AENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRH
  VCNINAVLLLAINIFLWGYFA

• Sequence length: 681

Pathways

Reactome:

Cellular hexose transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC5A9-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23350875	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31526853		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	40306283	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31526853	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31526853		★☆☆☆☆ Found in Text Mining only