Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1999
Gene name	E74 like ETS transcription factor 3
Gene symbol	ELF3
Synonyms (NCBI Gene)	EPR-1ERTESE-1ESX
Chromosome	1
Chromosome location	1q32.1

159

Show/Hide all (159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021421	hsa-miR-9-5p	Microarray	17612493
MIRT023041	hsa-miR-124-3p	Microarray	18668037
MIRT959991	hsa-miR-1207-3p	CLIP-seq
MIRT959992	hsa-miR-1254	CLIP-seq
MIRT959993	hsa-miR-127-5p	CLIP-seq
MIRT959994	hsa-miR-128	CLIP-seq
MIRT959995	hsa-miR-139-5p	CLIP-seq
MIRT959996	hsa-miR-194	CLIP-seq
MIRT959997	hsa-miR-2278	CLIP-seq
MIRT959998	hsa-miR-3116	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT960000	hsa-miR-338-5p	CLIP-seq
MIRT960001	hsa-miR-3622b-5p	CLIP-seq
MIRT960002	hsa-miR-3672	CLIP-seq
MIRT960003	hsa-miR-3688-3p	CLIP-seq
MIRT960004	hsa-miR-377	CLIP-seq
MIRT960005	hsa-miR-3974	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT960007	hsa-miR-4718	CLIP-seq
MIRT960008	hsa-miR-4720-5p	CLIP-seq
MIRT960009	hsa-miR-4761-5p	CLIP-seq
MIRT960010	hsa-miR-4768-5p	CLIP-seq
MIRT960011	hsa-miR-4786-3p	CLIP-seq
MIRT960012	hsa-miR-4799-3p	CLIP-seq
MIRT960013	hsa-miR-495	CLIP-seq
MIRT960014	hsa-miR-515-3p	CLIP-seq
MIRT960015	hsa-miR-519e	CLIP-seq
MIRT960016	hsa-miR-550a	CLIP-seq
MIRT960017	hsa-miR-607	CLIP-seq
MIRT960018	hsa-miR-660	CLIP-seq
MIRT960019	hsa-miR-661	CLIP-seq
MIRT960020	hsa-miR-668	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT960022	hsa-miR-942	CLIP-seq
MIRT960023	hsa-miR-1301	CLIP-seq
MIRT960024	hsa-miR-1304	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT960002	hsa-miR-3672	CLIP-seq
MIRT960027	hsa-miR-4329	CLIP-seq
MIRT960028	hsa-miR-4463	CLIP-seq
MIRT960029	hsa-miR-4660	CLIP-seq
MIRT960030	hsa-miR-5047	CLIP-seq
MIRT960031	hsa-miR-629	CLIP-seq
MIRT1984360	hsa-miR-1184	CLIP-seq
MIRT1984361	hsa-miR-1205	CLIP-seq
MIRT1984362	hsa-miR-1225-3p	CLIP-seq
MIRT1984363	hsa-miR-1231	CLIP-seq
MIRT1984364	hsa-miR-124	CLIP-seq
MIRT959992	hsa-miR-1254	CLIP-seq
MIRT1984365	hsa-miR-1286	CLIP-seq
MIRT1984366	hsa-miR-1296	CLIP-seq
MIRT1984367	hsa-miR-132	CLIP-seq
MIRT1984368	hsa-miR-136	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT1984369	hsa-miR-1910	CLIP-seq
MIRT1984370	hsa-miR-212	CLIP-seq
MIRT1984371	hsa-miR-2355-5p	CLIP-seq
MIRT1984372	hsa-miR-24	CLIP-seq
MIRT1984373	hsa-miR-2861	CLIP-seq
MIRT959998	hsa-miR-3116	CLIP-seq
MIRT1984374	hsa-miR-3158-5p	CLIP-seq
MIRT1984375	hsa-miR-3183	CLIP-seq
MIRT1984376	hsa-miR-3189-3p	CLIP-seq
MIRT1984377	hsa-miR-3189-5p	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT1984378	hsa-miR-338-3p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT1984379	hsa-miR-346	CLIP-seq
MIRT1984380	hsa-miR-3664-5p	CLIP-seq
MIRT1984381	hsa-miR-3689d	CLIP-seq
MIRT1984382	hsa-miR-3909	CLIP-seq
MIRT1984383	hsa-miR-3934	CLIP-seq
MIRT1984384	hsa-miR-4264	CLIP-seq
MIRT1984385	hsa-miR-4284	CLIP-seq
MIRT1984386	hsa-miR-4288	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT1984387	hsa-miR-4323	CLIP-seq
MIRT1984388	hsa-miR-4443	CLIP-seq
MIRT1984389	hsa-miR-4459	CLIP-seq
MIRT1984390	hsa-miR-4476	CLIP-seq
MIRT1984391	hsa-miR-4512	CLIP-seq
MIRT1984392	hsa-miR-4530	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT1984394	hsa-miR-4648	CLIP-seq
MIRT1984395	hsa-miR-4650-5p	CLIP-seq
MIRT1984396	hsa-miR-4654	CLIP-seq
MIRT1984397	hsa-miR-4690-3p	CLIP-seq
MIRT1984398	hsa-miR-4711-5p	CLIP-seq
MIRT1984399	hsa-miR-4722-5p	CLIP-seq
MIRT1984400	hsa-miR-4723-3p	CLIP-seq
MIRT1984401	hsa-miR-4769-5p	CLIP-seq
MIRT1984402	hsa-miR-506	CLIP-seq
MIRT1984403	hsa-miR-593	CLIP-seq
MIRT1984404	hsa-miR-632	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT2219487	hsa-miR-1	CLIP-seq
MIRT2219488	hsa-miR-1179	CLIP-seq
MIRT1984360	hsa-miR-1184	CLIP-seq
MIRT1984361	hsa-miR-1205	CLIP-seq
MIRT1984362	hsa-miR-1225-3p	CLIP-seq
MIRT1984363	hsa-miR-1231	CLIP-seq
MIRT1984365	hsa-miR-1286	CLIP-seq
MIRT2219489	hsa-miR-1321	CLIP-seq
MIRT2219490	hsa-miR-133a	CLIP-seq
MIRT2219491	hsa-miR-133b	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT2219492	hsa-miR-206	CLIP-seq
MIRT1984371	hsa-miR-2355-5p	CLIP-seq
MIRT1984373	hsa-miR-2861	CLIP-seq
MIRT1984374	hsa-miR-3158-5p	CLIP-seq
MIRT2219493	hsa-miR-3162-5p	CLIP-seq
MIRT2219494	hsa-miR-3184	CLIP-seq
MIRT1984377	hsa-miR-3189-5p	CLIP-seq
MIRT2219495	hsa-miR-3194-3p	CLIP-seq
MIRT1984378	hsa-miR-338-3p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT1984379	hsa-miR-346	CLIP-seq
MIRT2219496	hsa-miR-3545-5p	CLIP-seq
MIRT2219497	hsa-miR-3660	CLIP-seq
MIRT2219498	hsa-miR-3675-3p	CLIP-seq
MIRT2219499	hsa-miR-3680	CLIP-seq
MIRT1984383	hsa-miR-3934	CLIP-seq
MIRT2219500	hsa-miR-423-5p	CLIP-seq
MIRT2219501	hsa-miR-4256	CLIP-seq
MIRT2219502	hsa-miR-4281	CLIP-seq
MIRT1984386	hsa-miR-4288	CLIP-seq
MIRT2219503	hsa-miR-4449	CLIP-seq
MIRT1984389	hsa-miR-4459	CLIP-seq
MIRT1984390	hsa-miR-4476	CLIP-seq
MIRT1984391	hsa-miR-4512	CLIP-seq
MIRT2219504	hsa-miR-4526	CLIP-seq
MIRT2219505	hsa-miR-4529-5p	CLIP-seq
MIRT2219506	hsa-miR-4532	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT1984395	hsa-miR-4650-5p	CLIP-seq
MIRT1984397	hsa-miR-4690-3p	CLIP-seq
MIRT1984398	hsa-miR-4711-5p	CLIP-seq
MIRT1984399	hsa-miR-4722-5p	CLIP-seq
MIRT2219507	hsa-miR-4739	CLIP-seq
MIRT2219508	hsa-miR-4756-5p	CLIP-seq
MIRT2219509	hsa-miR-4798-3p	CLIP-seq
MIRT2219510	hsa-miR-613	CLIP-seq
MIRT1984404	hsa-miR-632	CLIP-seq
MIRT2448783	hsa-miR-1287	CLIP-seq
MIRT2448784	hsa-miR-18a	CLIP-seq
MIRT2448785	hsa-miR-18b	CLIP-seq
MIRT2448786	hsa-miR-198	CLIP-seq
MIRT2448787	hsa-miR-2054	CLIP-seq
MIRT2448788	hsa-miR-3135b	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT2448789	hsa-miR-4735-3p	CLIP-seq
MIRT2448790	hsa-miR-4779	CLIP-seq
MIRT959991	hsa-miR-1207-3p	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT960010	hsa-miR-4768-5p	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT960022	hsa-miR-942	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	12746898
RELA	Unknown	12746898

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9234700
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001824	Process	Blastocyst development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10821850
GO:0005515	Function	Protein binding	IPI	10391676, 12624109, 15075319, 26977885, 30476274, 32911434
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	9234700
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEP	14715662
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10773884
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9234700
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0060056	Process	Mammary gland involution	IEA
GO:0060056	Process	Mammary gland involution	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
602191	3318	ENSG00000163435

P78545

Protein name

ETS-related transcription factor Elf-3 (E74-like factor 3) (Epithelial-restricted with serine box) (Epithelium-restricted Ets protein ESX) (Epithelium-specific Ets transcription factor 1) (ESE-1)

Protein function

Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 pro

PDB

2E8P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02198	SAM_PNT	48 → 132	Sterile alpha motif (SAM)/Pointed domain	Domain
PF00178	Ets	274 → 355	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed exclusively in tissues containing a high content of terminally differentiated epithelial cells including mammary gland, colon, trachea, kidney, prostate, uterus, stomach and skin. {ECO:0000269|PubMed:9129154, ECO:0000269|PubM

Sequence

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWL
GEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ
LHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYH
PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDP
KHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHE
GVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSG
WKEEEVLQSRN

Sequence length

371

Interactions

View interactions

	Reactome
			Pre-NOTCH Transcription and Translation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY TRACT NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLARY RENAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (118)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15112339, 24390348, 31780666, 9395241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26977885, 31780666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	10891534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	16319692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12746898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34946850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	CTD_human_DG	26258846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasm	Biliary Tract Neoplasm	CTD_human_DG	26258846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31104013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	20920864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12477051, 12713734, 14997048, 15169914, 17172821, 17491012, 18628976, 23329352, 26920025, 29187433, 9129154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12031094, 15169914, 17172821, 17491012, 21871131, 28247944, 29187433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17172821, 34072506, 36329620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	24694612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29523781	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	33832503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	26806338, 28389139, 30620386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31104013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30015943, 31780666, 9395241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28199976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36329620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28199976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	29550824, 34250664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	19695674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25926267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Color Blindness, Blue	Color blindness	BEFREE	28403472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22993316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19074849, 24874735, 33402466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	22917924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	BEFREE	29656334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12746898, 27310669, 29550824, 29691435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18044710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28843780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24462878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31150422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12353671, 31703813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	31780666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	21124789, 25345090, 27142856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	31409603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GALACTOSIALIDOSIS	Galactosialidosis	BEFREE	15084520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	32839463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15112339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	30670517, 30695688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	29124014, 31073535, 31645300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33014189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease due to acid maltase deficiency, infantile onset	Glycogen Storage Disease	BEFREE	30214072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease due to acid maltase deficiency, late-onset	Glycogen Storage Disease	BEFREE	28433478, 30025991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	29124014, 31073535, 31645300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	35216615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	35607962	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	11230792, 12037725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal epithelial dysplasia	Intestinal Epithelial Dysplasia	BEFREE	17448233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	23643910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	26185364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11086180, 22677129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27827952, 29523781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34830169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27827952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11826770, 12477051, 12713734, 14767472, 14997048, 15169914, 17172821, 17491012, 18628976, 23329352, 26920025, 29187433, 9129154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12353671, 31703813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30015943, 31780666, 9395241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28199976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23687337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31019894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30365150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31104013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12713734, 16307850, 18628976, 29208568, 30015943, 30148686, 31780666, 9395241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14635793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis, MPS-IV-A	Mucopolysaccharidosis	BEFREE	29779903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30070690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12713734, 15112339, 16319692, 23435425, 23687337, 23723125, 26804919, 28199976, 30015943, 30148686, 31104013, 31780666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	31681015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	11086180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29208568, 29803922, 30015943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	9129154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29550824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12746898, 26603474, 29550824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28199976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28199976, 33493131, 38025760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30365150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	31780666		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	31780666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28843780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23687337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23687337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26856686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35472129	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12746898, 14715662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	12414507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	11073819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	11073819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	31196221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18302674, 23643910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18302674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35258410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23723125, 26227488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31019894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33618713, 36457025, 39350044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	15467754		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	17060315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	11230792, 12037725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30365150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30365150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22993316, 25926267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ureteral Neoplasms	Ureteral neoplasms	Pubtator	36818471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27699256, 31104013, 31233191, 34562599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	36951594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	29396390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	22917924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	35607962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ELF3 (E74 like ETS transcription factor 3)