Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	199699
Gene name	DAN domain BMP antagonist family member 5
Gene symbol	DAND5
Synonyms (NCBI Gene)	CER2CERL2CKTSF1B3COCOCRL2DANTEGREM3HTX13SP1
Chromosome	19
Chromosome location	19p13.13
Summary	This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene bel

276

Show/Hide all (276)

miRTarBase ID	miRNA	Experiments	Reference
MIRT704383	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT704382	hsa-miR-25-3p	HITS-CLIP	23313552
MIRT704381	hsa-miR-32-5p	HITS-CLIP	23313552
MIRT704380	hsa-miR-363-3p	HITS-CLIP	23313552
MIRT704379	hsa-miR-367-3p	HITS-CLIP	23313552
MIRT704378	hsa-miR-92a-3p	HITS-CLIP	23313552
MIRT704377	hsa-miR-92b-3p	HITS-CLIP	23313552
MIRT704376	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT704375	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT704374	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT704373	hsa-miR-6776-5p	HITS-CLIP	23313552
MIRT704372	hsa-miR-661	HITS-CLIP	23313552
MIRT704371	hsa-miR-542-3p	HITS-CLIP	23313552
MIRT704370	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT704369	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT704368	hsa-miR-7703	HITS-CLIP	23313552
MIRT704367	hsa-miR-4325	HITS-CLIP	23313552
MIRT704366	hsa-miR-1262	HITS-CLIP	23313552
MIRT704365	hsa-miR-4701-3p	HITS-CLIP	23313552
MIRT704364	hsa-miR-6736-5p	HITS-CLIP	23313552
MIRT704383	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT704382	hsa-miR-25-3p	HITS-CLIP	23313552
MIRT704381	hsa-miR-32-5p	HITS-CLIP	23313552
MIRT704380	hsa-miR-363-3p	HITS-CLIP	23313552
MIRT704379	hsa-miR-367-3p	HITS-CLIP	23313552
MIRT704378	hsa-miR-92a-3p	HITS-CLIP	23313552
MIRT704377	hsa-miR-92b-3p	HITS-CLIP	23313552
MIRT704376	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT704375	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT704374	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT704373	hsa-miR-6776-5p	HITS-CLIP	23313552
MIRT704372	hsa-miR-661	HITS-CLIP	23313552
MIRT704371	hsa-miR-542-3p	HITS-CLIP	23313552
MIRT704370	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT704369	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT704368	hsa-miR-7703	HITS-CLIP	23313552
MIRT704367	hsa-miR-4325	HITS-CLIP	23313552
MIRT704366	hsa-miR-1262	HITS-CLIP	23313552
MIRT704365	hsa-miR-4701-3p	HITS-CLIP	23313552
MIRT704364	hsa-miR-6736-5p	HITS-CLIP	23313552
MIRT923002	hsa-miR-10a	CLIP-seq
MIRT923003	hsa-miR-10b	CLIP-seq
MIRT923004	hsa-miR-1273	CLIP-seq
MIRT923005	hsa-miR-1290	CLIP-seq
MIRT923006	hsa-miR-1908	CLIP-seq
MIRT923007	hsa-miR-2114	CLIP-seq
MIRT923008	hsa-miR-219-1-3p	CLIP-seq
MIRT923009	hsa-miR-25	CLIP-seq
MIRT923010	hsa-miR-3122	CLIP-seq
MIRT923011	hsa-miR-3160-3p	CLIP-seq
MIRT923012	hsa-miR-3167	CLIP-seq
MIRT923013	hsa-miR-3174	CLIP-seq
MIRT923014	hsa-miR-3190	CLIP-seq
MIRT923015	hsa-miR-32	CLIP-seq
MIRT923016	hsa-miR-339-5p	CLIP-seq
MIRT923017	hsa-miR-3609	CLIP-seq
MIRT923018	hsa-miR-3613-3p	CLIP-seq
MIRT923019	hsa-miR-363	CLIP-seq
MIRT923020	hsa-miR-3656	CLIP-seq
MIRT923021	hsa-miR-3664-3p	CLIP-seq
MIRT923022	hsa-miR-367	CLIP-seq
MIRT923023	hsa-miR-3689a-3p	CLIP-seq
MIRT923024	hsa-miR-3689c	CLIP-seq
MIRT923025	hsa-miR-3689d	CLIP-seq
MIRT923026	hsa-miR-371-5p	CLIP-seq
MIRT923027	hsa-miR-371b-5p	CLIP-seq
MIRT923028	hsa-miR-3913-5p	CLIP-seq
MIRT923029	hsa-miR-3929	CLIP-seq
MIRT923030	hsa-miR-4252	CLIP-seq
MIRT923031	hsa-miR-4327	CLIP-seq
MIRT923032	hsa-miR-4329	CLIP-seq
MIRT923033	hsa-miR-4419b	CLIP-seq
MIRT923034	hsa-miR-4421	CLIP-seq
MIRT923035	hsa-miR-4433	CLIP-seq
MIRT923036	hsa-miR-4459	CLIP-seq
MIRT923037	hsa-miR-4478	CLIP-seq
MIRT923038	hsa-miR-4486	CLIP-seq
MIRT923039	hsa-miR-4487	CLIP-seq
MIRT923040	hsa-miR-4633-3p	CLIP-seq
MIRT923041	hsa-miR-4649-5p	CLIP-seq
MIRT923042	hsa-miR-4670-3p	CLIP-seq
MIRT923043	hsa-miR-4695-5p	CLIP-seq
MIRT923044	hsa-miR-4728-5p	CLIP-seq
MIRT923045	hsa-miR-4730	CLIP-seq
MIRT923046	hsa-miR-4768-3p	CLIP-seq
MIRT923047	hsa-miR-4793-3p	CLIP-seq
MIRT923048	hsa-miR-485-5p	CLIP-seq
MIRT923049	hsa-miR-510	CLIP-seq
MIRT923050	hsa-miR-511	CLIP-seq
MIRT923051	hsa-miR-512-5p	CLIP-seq
MIRT923052	hsa-miR-548ah	CLIP-seq
MIRT923053	hsa-miR-548c-3p	CLIP-seq
MIRT923054	hsa-miR-548t	CLIP-seq
MIRT923055	hsa-miR-550a	CLIP-seq
MIRT923056	hsa-miR-558	CLIP-seq
MIRT923057	hsa-miR-571	CLIP-seq
MIRT923058	hsa-miR-582-5p	CLIP-seq
MIRT923059	hsa-miR-640	CLIP-seq
MIRT923060	hsa-miR-663	CLIP-seq
MIRT923061	hsa-miR-766	CLIP-seq
MIRT923062	hsa-miR-876-5p	CLIP-seq
MIRT923063	hsa-miR-92a	CLIP-seq
MIRT923064	hsa-miR-92b	CLIP-seq
MIRT923004	hsa-miR-1273	CLIP-seq
MIRT923006	hsa-miR-1908	CLIP-seq
MIRT923007	hsa-miR-2114	CLIP-seq
MIRT923009	hsa-miR-25	CLIP-seq
MIRT923010	hsa-miR-3122	CLIP-seq
MIRT923011	hsa-miR-3160-3p	CLIP-seq
MIRT923014	hsa-miR-3190	CLIP-seq
MIRT923015	hsa-miR-32	CLIP-seq
MIRT1973455	hsa-miR-3618	CLIP-seq
MIRT1973456	hsa-miR-3622a-3p	CLIP-seq
MIRT1973457	hsa-miR-3622b-3p	CLIP-seq
MIRT923019	hsa-miR-363	CLIP-seq
MIRT923020	hsa-miR-3656	CLIP-seq
MIRT1973458	hsa-miR-3664-5p	CLIP-seq
MIRT923022	hsa-miR-367	CLIP-seq
MIRT1973459	hsa-miR-3672	CLIP-seq
MIRT923023	hsa-miR-3689a-3p	CLIP-seq
MIRT923024	hsa-miR-3689c	CLIP-seq
MIRT923028	hsa-miR-3913-5p	CLIP-seq
MIRT1973460	hsa-miR-3976	CLIP-seq
MIRT923030	hsa-miR-4252	CLIP-seq
MIRT923035	hsa-miR-4433	CLIP-seq
MIRT923036	hsa-miR-4459	CLIP-seq
MIRT923038	hsa-miR-4486	CLIP-seq
MIRT923039	hsa-miR-4487	CLIP-seq
MIRT1973461	hsa-miR-4522	CLIP-seq
MIRT1973462	hsa-miR-4649-3p	CLIP-seq
MIRT923041	hsa-miR-4649-5p	CLIP-seq
MIRT1973463	hsa-miR-4711-3p	CLIP-seq
MIRT923044	hsa-miR-4728-5p	CLIP-seq
MIRT923046	hsa-miR-4768-3p	CLIP-seq
MIRT1973464	hsa-miR-4786-5p	CLIP-seq
MIRT923047	hsa-miR-4793-3p	CLIP-seq
MIRT1973465	hsa-miR-4793-5p	CLIP-seq
MIRT1973466	hsa-miR-4794	CLIP-seq
MIRT923050	hsa-miR-511	CLIP-seq
MIRT1973467	hsa-miR-541	CLIP-seq
MIRT1973468	hsa-miR-544b	CLIP-seq
MIRT923055	hsa-miR-550a	CLIP-seq
MIRT923056	hsa-miR-558	CLIP-seq
MIRT923059	hsa-miR-640	CLIP-seq
MIRT1973469	hsa-miR-654-5p	CLIP-seq
MIRT923060	hsa-miR-663	CLIP-seq
MIRT1973470	hsa-miR-665	CLIP-seq
MIRT923061	hsa-miR-766	CLIP-seq
MIRT923063	hsa-miR-92a	CLIP-seq
MIRT923064	hsa-miR-92b	CLIP-seq
MIRT1973471	hsa-miR-934	CLIP-seq
MIRT1973472	hsa-miR-940	CLIP-seq
MIRT923004	hsa-miR-1273	CLIP-seq
MIRT2209026	hsa-miR-1285	CLIP-seq
MIRT2209027	hsa-miR-1293	CLIP-seq
MIRT923006	hsa-miR-1908	CLIP-seq
MIRT923007	hsa-miR-2114	CLIP-seq
MIRT923009	hsa-miR-25	CLIP-seq
MIRT2209028	hsa-miR-3151	CLIP-seq
MIRT2209029	hsa-miR-3187-5p	CLIP-seq
MIRT923015	hsa-miR-32	CLIP-seq
MIRT1973456	hsa-miR-3622a-3p	CLIP-seq
MIRT1973457	hsa-miR-3622b-3p	CLIP-seq
MIRT2209030	hsa-miR-3622b-5p	CLIP-seq
MIRT923019	hsa-miR-363	CLIP-seq
MIRT923020	hsa-miR-3656	CLIP-seq
MIRT1973458	hsa-miR-3664-5p	CLIP-seq
MIRT923022	hsa-miR-367	CLIP-seq
MIRT2209031	hsa-miR-3714	CLIP-seq
MIRT923029	hsa-miR-3929	CLIP-seq
MIRT2209032	hsa-miR-3945	CLIP-seq
MIRT1973460	hsa-miR-3976	CLIP-seq
MIRT923030	hsa-miR-4252	CLIP-seq
MIRT2209033	hsa-miR-4253	CLIP-seq
MIRT923032	hsa-miR-4329	CLIP-seq
MIRT923033	hsa-miR-4419b	CLIP-seq
MIRT923035	hsa-miR-4433	CLIP-seq
MIRT923036	hsa-miR-4459	CLIP-seq
MIRT923037	hsa-miR-4478	CLIP-seq
MIRT2209034	hsa-miR-4483	CLIP-seq
MIRT923038	hsa-miR-4486	CLIP-seq
MIRT2209035	hsa-miR-4514	CLIP-seq
MIRT2209036	hsa-miR-4517	CLIP-seq
MIRT2209037	hsa-miR-4529-5p	CLIP-seq
MIRT1973462	hsa-miR-4649-3p	CLIP-seq
MIRT923041	hsa-miR-4649-5p	CLIP-seq
MIRT2209038	hsa-miR-4692	CLIP-seq
MIRT2209039	hsa-miR-4755-3p	CLIP-seq
MIRT923046	hsa-miR-4768-3p	CLIP-seq
MIRT1973464	hsa-miR-4786-5p	CLIP-seq
MIRT923047	hsa-miR-4793-3p	CLIP-seq
MIRT1973465	hsa-miR-4793-5p	CLIP-seq
MIRT923048	hsa-miR-485-5p	CLIP-seq
MIRT1973468	hsa-miR-544b	CLIP-seq
MIRT923055	hsa-miR-550a	CLIP-seq
MIRT2209040	hsa-miR-612	CLIP-seq
MIRT923060	hsa-miR-663	CLIP-seq
MIRT1973470	hsa-miR-665	CLIP-seq
MIRT923061	hsa-miR-766	CLIP-seq
MIRT923063	hsa-miR-92a	CLIP-seq
MIRT923064	hsa-miR-92b	CLIP-seq
MIRT1973472	hsa-miR-940	CLIP-seq
MIRT2209026	hsa-miR-1285	CLIP-seq
MIRT2448023	hsa-miR-3120-5p	CLIP-seq
MIRT2209029	hsa-miR-3187-5p	CLIP-seq
MIRT2209030	hsa-miR-3622b-5p	CLIP-seq
MIRT1973458	hsa-miR-3664-5p	CLIP-seq
MIRT2209032	hsa-miR-3945	CLIP-seq
MIRT2209033	hsa-miR-4253	CLIP-seq
MIRT2448024	hsa-miR-4684-5p	CLIP-seq
MIRT2448025	hsa-miR-4738-3p	CLIP-seq
MIRT923053	hsa-miR-548c-3p	CLIP-seq
MIRT2448026	hsa-miR-593	CLIP-seq
MIRT2209040	hsa-miR-612	CLIP-seq
MIRT923002	hsa-miR-10a	CLIP-seq
MIRT923003	hsa-miR-10b	CLIP-seq
MIRT923004	hsa-miR-1273	CLIP-seq
MIRT2209026	hsa-miR-1285	CLIP-seq
MIRT923006	hsa-miR-1908	CLIP-seq
MIRT2448023	hsa-miR-3120-5p	CLIP-seq
MIRT2209029	hsa-miR-3187-5p	CLIP-seq
MIRT923016	hsa-miR-339-5p	CLIP-seq
MIRT923018	hsa-miR-3613-3p	CLIP-seq
MIRT2209030	hsa-miR-3622b-5p	CLIP-seq
MIRT923020	hsa-miR-3656	CLIP-seq
MIRT1973458	hsa-miR-3664-5p	CLIP-seq
MIRT923026	hsa-miR-371-5p	CLIP-seq
MIRT923027	hsa-miR-371b-5p	CLIP-seq
MIRT2209032	hsa-miR-3945	CLIP-seq
MIRT923030	hsa-miR-4252	CLIP-seq
MIRT2209033	hsa-miR-4253	CLIP-seq
MIRT923034	hsa-miR-4421	CLIP-seq
MIRT923038	hsa-miR-4486	CLIP-seq
MIRT2209036	hsa-miR-4517	CLIP-seq
MIRT923041	hsa-miR-4649-5p	CLIP-seq
MIRT2448024	hsa-miR-4684-5p	CLIP-seq
MIRT2448025	hsa-miR-4738-3p	CLIP-seq
MIRT923047	hsa-miR-4793-3p	CLIP-seq
MIRT923050	hsa-miR-511	CLIP-seq
MIRT923053	hsa-miR-548c-3p	CLIP-seq
MIRT923055	hsa-miR-550a	CLIP-seq
MIRT2448026	hsa-miR-593	CLIP-seq
MIRT2209040	hsa-miR-612	CLIP-seq
MIRT923060	hsa-miR-663	CLIP-seq
MIRT923061	hsa-miR-766	CLIP-seq
MIRT923002	hsa-miR-10a	CLIP-seq
MIRT923003	hsa-miR-10b	CLIP-seq
MIRT923004	hsa-miR-1273	CLIP-seq
MIRT2209026	hsa-miR-1285	CLIP-seq
MIRT923006	hsa-miR-1908	CLIP-seq
MIRT2448023	hsa-miR-3120-5p	CLIP-seq
MIRT2209029	hsa-miR-3187-5p	CLIP-seq
MIRT923016	hsa-miR-339-5p	CLIP-seq
MIRT923018	hsa-miR-3613-3p	CLIP-seq
MIRT2209030	hsa-miR-3622b-5p	CLIP-seq
MIRT923020	hsa-miR-3656	CLIP-seq
MIRT1973458	hsa-miR-3664-5p	CLIP-seq
MIRT923026	hsa-miR-371-5p	CLIP-seq
MIRT923027	hsa-miR-371b-5p	CLIP-seq
MIRT2209032	hsa-miR-3945	CLIP-seq
MIRT923030	hsa-miR-4252	CLIP-seq
MIRT2209033	hsa-miR-4253	CLIP-seq
MIRT923034	hsa-miR-4421	CLIP-seq
MIRT923038	hsa-miR-4486	CLIP-seq
MIRT2209036	hsa-miR-4517	CLIP-seq
MIRT923041	hsa-miR-4649-5p	CLIP-seq
MIRT2448024	hsa-miR-4684-5p	CLIP-seq
MIRT2448025	hsa-miR-4738-3p	CLIP-seq
MIRT923047	hsa-miR-4793-3p	CLIP-seq
MIRT923050	hsa-miR-511	CLIP-seq
MIRT923053	hsa-miR-548c-3p	CLIP-seq
MIRT923055	hsa-miR-550a	CLIP-seq
MIRT2448026	hsa-miR-593	CLIP-seq
MIRT2209040	hsa-miR-612	CLIP-seq
MIRT923060	hsa-miR-663	CLIP-seq
MIRT923061	hsa-miR-766	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003140	Process	Determination of left/right asymmetry in lateral mesoderm	IEA
GO:0003140	Process	Determination of left/right asymmetry in lateral mesoderm	ISS
GO:0003140	Process	Determination of left/right asymmetry in lateral mesoderm	NAS	17507406
GO:0003281	Process	Ventricular septum development	IEA
GO:0003281	Process	Ventricular septum development	ISS
GO:0003283	Process	Atrial septum development	IEA
GO:0003283	Process	Atrial septum development	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	15466485
GO:0005615	Component	Extracellular space	IBA
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007368	Process	Determination of left/right symmetry	ISS
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0016015	Function	Morphogen activity	IBA
GO:0016015	Function	Morphogen activity	IEA
GO:0016015	Function	Morphogen activity	ISS
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IBA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	ISS
GO:0035582	Process	Sequestering of BMP in extracellular matrix	IBA
GO:0038092	Process	Nodal signaling pathway	NAS	17507406
GO:0038101	Process	Sequestering of nodal from receptor via nodal binding	IEA
GO:0038101	Process	Sequestering of nodal from receptor via nodal binding	ISS
GO:0061371	Process	Determination of heart left/right asymmetry	IBA
GO:0061371	Process	Determination of heart left/right asymmetry	IEA
GO:0061371	Process	Determination of heart left/right asymmetry	ISS
GO:1900108	Process	Negative regulation of nodal signaling pathway	IEA
GO:1900108	Process	Negative regulation of nodal signaling pathway	ISS

MIM	HGNC	e!Ensembl
609068	26780	ENSG00000179284

Q8N907

Protein name

DAN domain family member 5 (Cerberus-like protein 2) (Cerl-2) (Cysteine knot superfamily 1, BMP antagonist 3) (Gremlin-3)

Protein function

Antagonist of the extracellular signaling protein NODAL, which is required for correct left-right patterning during embryonic development (By similarity). Antagonist of BMP and TGF-beta signaling (PubMed:33587337). Independently of its role in l

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03045	DAN	76 → 188	DAN domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the retina, in inner segments of photoreceptors, at or close to the outer plexiform layer and in the ganglion cell layer (at protein level). {ECO:0000269|PubMed:33587337}.

Sequence

MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSW
KAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRL
RNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLI
EGCHCSPKA

Sequence length

189

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Heterotaxy	Likely pathogenic; Pathogenic	rs768842269	RCV001732154	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heterotaxy, visceral, 13, autosomal	Uncertain significance	ClinVar ClinVar, HPO ClinVar, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SITUS AMBIGUUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (204)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23649655, 29575609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	18628415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16087722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15972967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31545826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	31545826		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28352075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17957039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12911785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29948615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17957039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36071548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22030357		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30127893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	BEFREE	25917456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18593936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	15466008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	32636268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11559575, 16260418, 16707431, 25193278, 26645832, 27572271, 28498645, 30654518, 30846409, 30941230, 31742423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16204032, 16260418, 22728919, 27572271, 28990063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40666524	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29948615, 33125142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	1282800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	28631560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26317792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12007195, 18559520, 20384626, 20570896, 21246532, 22158040, 22956772, 23047008, 23649655, 24647869, 28529241, 29575609, 30875336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27057636, 28352075, 30976063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21316605, 27581819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	39294340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	22086197, 25479176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32744319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24018208, 25418289, 28641487, 29241478, 31252264, 31303791, 6604031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24018208, 25418289, 28641487, 29241478, 31252264, 31303791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31236000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	25175639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	PSYGENET_DG	25175639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	28230599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23877322, 30362980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12466967, 17689681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28237576, 28427500, 28815037, 30474556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15004200, 30474556, 34420031, 35068341, 37786278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18811981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	28738792, 29136563		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29312804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28738792, 29136563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	35968900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	18423053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30626802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	Pubtator	11505338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	31446527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29747385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	21208652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29748291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29748291, 30275758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15338456, 32714075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27112839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27311771, 28341181, 31094072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	21555589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21208652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25327560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	17442906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	20047772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27581819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20502940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28025760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	LHGDN	15955096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	22198906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	18972440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	15705902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19318640, 28822335, 29257212, 9420220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24552705, 29257212, 32328646, 32838835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19318640, 24951112, 28822335, 29257212, 9420220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17616668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25428991, 27058528, 28831025, 30973678, 31400609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34643249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	21576248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	28738792, 29136563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29730570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	28738792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heterotaxy Syndrome	Heterotaxy syndrome	Pubtator	36316122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	16442295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	24378567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	CTD_human_DG	11696579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28104396, 28341181, 31094072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	23315940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	24378567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16565233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Right Ventricular	Right ventricular hypertrophy	Pubtator	28738792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	31847126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	40510349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	LHGDN	17893646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30212930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22289984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	27460077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	16378688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25310400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12133007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21214951, 26177288, 26317792, 26481868, 26763486, 28262799, 28623129, 28627662, 29128513, 29387246, 31199573, 31452716, 9403717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21246532, 23649655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22158040, 22956772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21757709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21097497, 21757709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19318640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11559575, 16260418, 16707431, 25193278, 26645832, 27572271, 28498645, 30654518, 30846409, 30941230, 31742423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25327560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28878246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12007195, 18559520, 20384626, 20570896, 21246532, 22158040, 22956772, 23047008, 23649655, 24647869, 28529241, 29575609, 30875336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25310400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21316605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15026340, 20086170, 22342309, 22564704, 28484232, 29738634, 30696421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12954495, 21241418, 25044704, 27285981, 29094170, 29342271, 31422115, 31608997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	22009531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	29027311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16035620, 16158248, 21822301, 29328444, 30449701, 30614038, 31579418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16260418, 20384626, 22119201, 22158040, 22558411, 23018034, 23104175, 23394613, 23437057, 23877322, 23877711, 24130169, 25738304, 25773124, 25960131 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24018208, 25418289, 28641487, 29241478, 31252264, 31303791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23877322, 30362980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12052832, 12151347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26645832		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12789289, 27611953		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16964286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	14735580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22552784, 23525508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22734486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	16964286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18502099, 21856768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	30115673, 31536933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22119415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	32636268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	15466927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	28503426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26922862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	26261581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12796395, 15254745, 17085651, 17363604, 19772640, 20086170, 21131823, 21241418, 22158040, 22342309, 22552784, 22992725, 23562784, 23686785, 25192290 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26687764, 30485136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28469795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22992725, 24680773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	23941741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26645832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	15880349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10091149, 14734826, 15241219, 21178584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	35620387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25092376, 29088790, 29740498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	15241219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	Pubtator	32126815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	25060396		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16714763, 18353772		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21316605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16825507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15026340, 20086170, 22342309, 22564704, 28484232, 28769562, 29738634, 30696421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28484232, 35982909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30779082, 31478331, 31791587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16378688, 30004136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32714075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21309719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	16378688		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	20047772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	LHGDN	17890878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31115532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	15801966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	16410262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	16378688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASCAT_DG	30089514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	20047772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12954495, 25044704, 27285981, 29094170, 29342271, 31422115, 31608997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15064717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32851058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protoporphyria Erythropoietic	Erythropoietic protoporphyria	Pubtator	15850836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	23941741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	22198906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11757622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21465530, 21880723, 28627594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15475466, 22815231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29148420, 29179491, 29844591, 30233580, 31156654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	14977835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	17192956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17786189, 23540600, 23941741, 30167782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	17786189, 23540600, 23941741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11037883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	19164126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	22009531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida Cystica	Spina Bifida Cystica	BEFREE	14735580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Splanchnic vein thrombosis	Splanchnic vein thrombosis	BEFREE	17442906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23877235, 24423061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20502940, 30867685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31270251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28356969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	27840225, 29749377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18972440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16035620, 16158248, 21822301, 23437057, 29328444, 30449701, 31579418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15217947, 16158248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21822301, 28117748, 34159436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11037883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	16378688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	LHGDN	16378688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	28738792, 31138201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18509005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37686205, 39419019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22900953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28641487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	35607962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	26370050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33370782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	26370050		★★★★★ ★☆☆☆☆ Found in Text Mining only

DAND5 (DAN domain BMP antagonist family member 5)