Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1996
Gene name	ELAV like RNA binding protein 4
Gene symbol	ELAVL4
Synonyms (NCBI Gene)	HUDPNEM
Chromosome	1
Chromosome location	1p33-p32.3

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005543	hsa-miR-375	GFP reporter assayImmunohistochemistryMicroarrayqRT-PCRWestern blot	20584986
MIRT005543	hsa-miR-375	GFP reporter assayImmunohistochemistryMicroarrayqRT-PCRWestern blot	20584986
MIRT005543	hsa-miR-375	Reporter assay;Western blot;qRT-PCR;Microarray;Other	20584986
MIRT021646	hsa-miR-141-3p	qRT-PCR	20584986
MIRT030948	hsa-miR-21-5p	qRT-PCR	20584986
MIRT658748	hsa-miR-10b-3p	HITS-CLIP	23824327
MIRT658747	hsa-miR-488-5p	HITS-CLIP	23824327
MIRT658746	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT658745	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT658744	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT658743	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT658742	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT658741	hsa-miR-643	HITS-CLIP	23824327
MIRT658740	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT658739	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT658738	hsa-miR-607	HITS-CLIP	23824327
MIRT449635	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT449634	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT449633	hsa-miR-3163	PAR-CLIP	22100165
MIRT449632	hsa-miR-4635	PAR-CLIP	22100165
MIRT449631	hsa-miR-340-5p	PAR-CLIP	22100165
MIRT449630	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT449629	hsa-miR-578	PAR-CLIP	22100165
MIRT449628	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT658748	hsa-miR-10b-3p	HITS-CLIP	23824327
MIRT658747	hsa-miR-488-5p	HITS-CLIP	23824327
MIRT658746	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT658745	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT658744	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT658743	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT658742	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT658741	hsa-miR-643	HITS-CLIP	23824327
MIRT658740	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT658739	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT658738	hsa-miR-607	HITS-CLIP	23824327
MIRT449635	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT449634	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT449633	hsa-miR-3163	PAR-CLIP	22100165
MIRT449632	hsa-miR-4635	PAR-CLIP	22100165
MIRT449631	hsa-miR-340-5p	PAR-CLIP	22100165
MIRT449630	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT449629	hsa-miR-578	PAR-CLIP	22100165
MIRT449628	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT756137	hsa-miR-142-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunofluorescenceFlow cytometry	38632655
MIRT959829	hsa-miR-4795-3p	CLIP-seq
MIRT959830	hsa-miR-2053	CLIP-seq
MIRT959831	hsa-miR-409-3p	CLIP-seq
MIRT959832	hsa-miR-4477a	CLIP-seq
MIRT959833	hsa-miR-569	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IDA	12468554, 18218628
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	TAS	10848602
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006396	Process	RNA processing	IDA	17035636
GO:0006397	Process	MRNA processing	IEA
GO:0006397	Process	MRNA processing	TAS	10348344
GO:0007612	Process	Learning	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008143	Function	Poly(A) binding	IDA	12034726
GO:0008380	Process	RNA splicing	IEA
GO:0021895	Process	Cerebral cortex neuron differentiation	IEA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	IEA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	10710437, 12034726, 17234598
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	12034726
GO:0097158	Function	Pre-mRNA intronic pyrimidine-rich binding	IDA	17035636
GO:1905870	Process	Positive regulation of 3'-UTR-mediated mRNA stabilization	IDA	18218628
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
168360	3315	ENSG00000162374

P26378

Protein name

ELAV-like protein 4 (Hu-antigen D) (HuD) (Paraneoplastic encephalomyelitis antigen HuD)

Protein function

RNA-binding protein that is involved in the post-transcriptional regulation of mRNAs (PubMed:10710437, PubMed:12034726, PubMed:12468554, PubMed:17035636, PubMed:17234598, PubMed:7898713). Plays a role in the regulation of mRNA stability, alterna

PDB

1FXL , 1G2E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	53 → 123	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	139 → 207	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	304 → 374	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in pancreatic beta cells (at protein level) (PubMed:22387028). Expressed in the brain (PubMed:14702039, PubMed:1655278). {ECO:0000269|PubMed:14702039, ECO:0000269|PubMed:1655278, ECO:0000269|PubMed:22387028}.

Sequence

MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQ
NMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTK
TIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGV
GFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPG
PLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGT
GWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAI
ASLNGYRLGDRVLQVSFKTNKAHKS

Sequence length

385

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	35843356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31242416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31242416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27725125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	8069866, 9288629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22011044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34588521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19410329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30718901		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of lung	Lung Cancer	BEFREE	19410329, 8069866, 9288629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	22965691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27725125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16384890, 28739747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28767316	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	15827745, 17230446, 18587682, 24156912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	15827745, 18587682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	18587682, 24156912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	17230446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	28991256, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	14512168, 27725125, 28739747, 8069866, 9288629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	18607064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	28635376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	18587682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ELAVL4 (ELAV like RNA binding protein 4)