Gene Gene information from NCBI Gene database.
Entrez ID 1995
Gene name ELAV like RNA binding protein 3
Gene symbol ELAVL3
Synonyms (NCBI Gene)
HUCHUCLPLE21
Chromosome 19
Chromosome location 19p13.2
Summary A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized
miRNA miRNA information provided by mirtarbase database.
368
miRTarBase ID miRNA Experiments Reference
MIRT028772 hsa-miR-26b-5p Microarray 19088304
MIRT624046 hsa-miR-5088-3p HITS-CLIP 23824327
MIRT624045 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT624044 hsa-miR-6817-3p HITS-CLIP 23824327
MIRT624042 hsa-miR-130b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IEA
GO:0005515 Function Protein binding IPI 36950384, 37207277
GO:0007399 Process Nervous system development IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603458 3314 ENSG00000196361
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14576
Protein name ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21)
Protein function RNA-binding protein that binds to AU-rich element (ARE) sequences of target mRNAs, including VEGF mRNA (PubMed:10710437). May also bind poly-A tracts via RRM 3 (By similarity). May be involved in neuronal differentiation and maintenance (By simi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 41 111 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 127 195 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 286 356 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Brain specific.
Sequence
MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFG
SIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIK
VSYARPSSA
SIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAE
EAIKGLNGQKPLGAA
EPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLD
NLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVL
WQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQ
VSFK
TSKQHKA
Sequence length 367
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amyotrophic lateral sclerosis 1 Amyotrophic lateral sclerosis Pubtator 34618203 Associate
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism Pubtator 37076741 Associate
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 17982617, 22057916, 24571540, 25878394, 28599483, 29115412, 29328435, 29367676, 29872024, 30214503, 30458442, 30674231, 31072448, 31298320
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 17982617, 22057916, 24571540, 25878394, 28599483, 29115412, 29328435, 29367676, 29872024, 30214503, 30458442, 30674231, 31072448, 31298320
★☆☆☆☆
Found in Text Mining only
Cerebellar Diseases Cerebellar Diseases BEFREE 29614249
★☆☆☆☆
Found in Text Mining only
Crohn Disease Crohn Disease BEFREE 28222161
★☆☆☆☆
Found in Text Mining only
Developmental Disabilities Developmental disability Pubtator 37501076 Associate
★☆☆☆☆
Found in Text Mining only
Idiopathic Pulmonary Fibrosis Pulmonary Fibrosis BEFREE 28565787
★☆☆☆☆
Found in Text Mining only
Interstitial Cystitis Interstitial Cystitis BEFREE 29137981
★☆☆☆☆
Found in Text Mining only
Ischemic Stroke Ischemic stroke Pubtator 32815572 Associate
★☆☆☆☆
Found in Text Mining only