ELAVL1 (ELAV like RNA binding protein 1)

Gene

• Entrez ID: 1994
• Gene name: ELAV like RNA binding protein 1
• Gene symbol: ELAVL1
• Synonyms (NCBI Gene): ELAV1, HUR, Hua, MelG
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3` untranslated regions of mRNAs. AREs signal degradation of mR

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003731	hsa-miR-519b-3p	qRT-PCR, Western blot	19088191
MIRT003731	hsa-miR-519b-3p	qRT-PCR, Western blot	19088191
MIRT003732	hsa-miR-519c-3p	qRT-PCR, Western blot	19088191
MIRT003732	hsa-miR-519c-3p	qRT-PCR, Western blot	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR, Western blot	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR, Western blot	19088191
MIRT003731	hsa-miR-519b-3p	Western blot	19088191
MIRT003731	hsa-miR-519b-3p	qRT-PCR	19088191
MIRT003732	hsa-miR-519c-3p	Western blot	19088191
MIRT003732	hsa-miR-519c-3p	qRT-PCR	19088191
MIRT003733	hsa-miR-519a-3p	Western blot	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR	19088191
MIRT003731	hsa-miR-519b-3p	Western blot	19088191
MIRT003731	hsa-miR-519b-3p	qRT-PCR	19088191
MIRT003732	hsa-miR-519c-3p	Western blot	19088191
MIRT003732	hsa-miR-519c-3p	qRT-PCR	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR, Western blot	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR	19088191
MIRT005421	hsa-miR-125a-5p	Luciferase reporter assay, Western blot	19875930
MIRT019606	hsa-miR-340-5p	Sequencing	20371350
MIRT048754	hsa-miR-93-5p	CLASH	23622248
MIRT054041	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	22310293
MIRT054580	hsa-miR-146a-5p	Immunoprecipitation, Luciferase reporter assay, QRTPCR, Western blot	23733368
MIRT574799	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT574798	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT574797	hsa-miR-8063	PAR-CLIP	20371350
MIRT498257	hsa-miR-4694-3p	PAR-CLIP	22291592
MIRT498256	hsa-miR-224-3p	PAR-CLIP	22291592
MIRT498255	hsa-miR-522-3p	PAR-CLIP	22291592
MIRT498254	hsa-miR-3926	PAR-CLIP	22291592
MIRT498253	hsa-miR-548s	PAR-CLIP	22291592
MIRT441589	hsa-miR-4769-3p	PAR-CLIP	22100165
MIRT441588	hsa-miR-6817-5p	PAR-CLIP	22100165
MIRT440727	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440727	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731587	hsa-miR-296-5p	Luciferase reporter assay	26898797
MIRT731587	hsa-miR-296-5p	Luciferase reporter assay	26898797
MIRT731587	hsa-miR-296-5p	Luciferase reporter assay	26898797
MIRT054580	hsa-miR-146a-5p	Western blotting, RNA-seq, qRT-PCR	31425002
MIRT734817	hsa-miR-16-5p	Microarray	33530159
MIRT736017	hsa-miR-1246	Western blotting, qRT-PCR	31506750
MIRT574799	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT574798	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT574797	hsa-miR-8063	PAR-CLIP	20371350
MIRT498257	hsa-miR-4694-3p	PAR-CLIP	22291592
MIRT498256	hsa-miR-224-3p	PAR-CLIP	22291592
MIRT498255	hsa-miR-522-3p	PAR-CLIP	22291592
MIRT498254	hsa-miR-3926	PAR-CLIP	22291592
MIRT498253	hsa-miR-548s	PAR-CLIP	22291592
MIRT441589	hsa-miR-4769-3p	PAR-CLIP	22100165
MIRT441588	hsa-miR-6817-5p	PAR-CLIP	22100165
MIRT959677	hsa-miR-1200	CLIP-seq
MIRT959678	hsa-miR-1254	CLIP-seq
MIRT959679	hsa-miR-1273e	CLIP-seq
MIRT959680	hsa-miR-1304	CLIP-seq
MIRT959681	hsa-miR-145	CLIP-seq
MIRT959682	hsa-miR-147	CLIP-seq
MIRT959683	hsa-miR-150	CLIP-seq
MIRT959684	hsa-miR-15a	CLIP-seq
MIRT959685	hsa-miR-15b	CLIP-seq
MIRT959686	hsa-miR-16	CLIP-seq
MIRT959687	hsa-miR-1827	CLIP-seq
MIRT959688	hsa-miR-1910	CLIP-seq
MIRT959689	hsa-miR-195	CLIP-seq
MIRT959690	hsa-miR-2110	CLIP-seq
MIRT959691	hsa-miR-300	CLIP-seq
MIRT959692	hsa-miR-3116	CLIP-seq
MIRT959693	hsa-miR-3140-3p	CLIP-seq
MIRT959694	hsa-miR-3140-5p	CLIP-seq
MIRT959695	hsa-miR-3143	CLIP-seq
MIRT959696	hsa-miR-3148	CLIP-seq
MIRT959697	hsa-miR-3152-3p	CLIP-seq
MIRT959698	hsa-miR-3154	CLIP-seq
MIRT959699	hsa-miR-3168	CLIP-seq
MIRT959700	hsa-miR-3199	CLIP-seq
MIRT959701	hsa-miR-3545-3p	CLIP-seq
MIRT959702	hsa-miR-3611	CLIP-seq
MIRT959703	hsa-miR-3613-3p	CLIP-seq
MIRT959704	hsa-miR-3647-3p	CLIP-seq
MIRT959705	hsa-miR-3649	CLIP-seq
MIRT959706	hsa-miR-3672	CLIP-seq
MIRT959707	hsa-miR-3688-5p	CLIP-seq
MIRT959708	hsa-miR-3689a-3p	CLIP-seq
MIRT959709	hsa-miR-3689c	CLIP-seq
MIRT959710	hsa-miR-3689d	CLIP-seq
MIRT959711	hsa-miR-3714	CLIP-seq
MIRT959712	hsa-miR-378g	CLIP-seq
MIRT959713	hsa-miR-381	CLIP-seq
MIRT959714	hsa-miR-3911	CLIP-seq
MIRT959715	hsa-miR-3922-5p	CLIP-seq
MIRT959716	hsa-miR-3940-3p	CLIP-seq
MIRT959717	hsa-miR-3945	CLIP-seq
MIRT959718	hsa-miR-424	CLIP-seq
MIRT959719	hsa-miR-4251	CLIP-seq
MIRT959720	hsa-miR-4253	CLIP-seq
MIRT959721	hsa-miR-4271	CLIP-seq
MIRT959722	hsa-miR-4277	CLIP-seq
MIRT959723	hsa-miR-4326	CLIP-seq
MIRT959724	hsa-miR-4421	CLIP-seq
MIRT959725	hsa-miR-4426	CLIP-seq
MIRT959726	hsa-miR-4450	CLIP-seq
MIRT959727	hsa-miR-4459	CLIP-seq
MIRT959728	hsa-miR-4468	CLIP-seq
MIRT959729	hsa-miR-4539	CLIP-seq
MIRT959730	hsa-miR-455-3p	CLIP-seq
MIRT959731	hsa-miR-4647	CLIP-seq
MIRT959732	hsa-miR-4648	CLIP-seq
MIRT959733	hsa-miR-4652-3p	CLIP-seq
MIRT959734	hsa-miR-4654	CLIP-seq
MIRT959735	hsa-miR-4662b	CLIP-seq
MIRT959736	hsa-miR-4666-3p	CLIP-seq
MIRT959737	hsa-miR-4667-5p	CLIP-seq
MIRT959738	hsa-miR-4698	CLIP-seq
MIRT959739	hsa-miR-4700-5p	CLIP-seq
MIRT959740	hsa-miR-4722-5p	CLIP-seq
MIRT959741	hsa-miR-4725-3p	CLIP-seq
MIRT959742	hsa-miR-4728-5p	CLIP-seq
MIRT959743	hsa-miR-4740-5p	CLIP-seq
MIRT959744	hsa-miR-4760-5p	CLIP-seq
MIRT959745	hsa-miR-4765	CLIP-seq
MIRT959746	hsa-miR-4769-5p	CLIP-seq
MIRT959747	hsa-miR-4773	CLIP-seq
MIRT959748	hsa-miR-4803	CLIP-seq
MIRT959749	hsa-miR-492	CLIP-seq
MIRT959750	hsa-miR-497	CLIP-seq
MIRT959751	hsa-miR-505	CLIP-seq
MIRT959752	hsa-miR-509-3p	CLIP-seq
MIRT959753	hsa-miR-518e	CLIP-seq
MIRT959754	hsa-miR-539	CLIP-seq
MIRT959755	hsa-miR-548p	CLIP-seq
MIRT959756	hsa-miR-550a	CLIP-seq
MIRT959757	hsa-miR-580	CLIP-seq
MIRT959758	hsa-miR-637	CLIP-seq
MIRT959759	hsa-miR-644	CLIP-seq
MIRT959760	hsa-miR-661	CLIP-seq
MIRT959761	hsa-miR-875-3p	CLIP-seq
MIRT959762	hsa-miR-877	CLIP-seq
MIRT959763	hsa-miR-889	CLIP-seq
MIRT1984280	hsa-miR-1178	CLIP-seq
MIRT1984281	hsa-miR-1206	CLIP-seq
MIRT1984282	hsa-miR-1229	CLIP-seq
MIRT1984283	hsa-miR-1243	CLIP-seq
MIRT959678	hsa-miR-1254	CLIP-seq
MIRT1984284	hsa-miR-1299	CLIP-seq
MIRT1984285	hsa-miR-133a	CLIP-seq
MIRT1984286	hsa-miR-133b	CLIP-seq
MIRT1984287	hsa-miR-137	CLIP-seq
MIRT959682	hsa-miR-147	CLIP-seq
MIRT1984288	hsa-miR-197	CLIP-seq
MIRT959692	hsa-miR-3116	CLIP-seq
MIRT959696	hsa-miR-3148	CLIP-seq
MIRT959697	hsa-miR-3152-3p	CLIP-seq
MIRT1984289	hsa-miR-3194-3p	CLIP-seq
MIRT1984290	hsa-miR-330-3p	CLIP-seq
MIRT1984291	hsa-miR-345	CLIP-seq
MIRT959703	hsa-miR-3613-3p	CLIP-seq
MIRT959704	hsa-miR-3647-3p	CLIP-seq
MIRT959705	hsa-miR-3649	CLIP-seq
MIRT1984292	hsa-miR-3654	CLIP-seq
MIRT1984293	hsa-miR-3659	CLIP-seq
MIRT959707	hsa-miR-3688-5p	CLIP-seq
MIRT959710	hsa-miR-3689d	CLIP-seq
MIRT1984294	hsa-miR-377	CLIP-seq
MIRT959714	hsa-miR-3911	CLIP-seq
MIRT1984295	hsa-miR-3937	CLIP-seq
MIRT1984296	hsa-miR-3977	CLIP-seq
MIRT1984297	hsa-miR-4254	CLIP-seq
MIRT1984298	hsa-miR-4255	CLIP-seq
MIRT959724	hsa-miR-4421	CLIP-seq
MIRT1984299	hsa-miR-4422	CLIP-seq
MIRT959727	hsa-miR-4459	CLIP-seq
MIRT959728	hsa-miR-4468	CLIP-seq
MIRT1984300	hsa-miR-4522	CLIP-seq
MIRT1984301	hsa-miR-4633-3p	CLIP-seq
MIRT959733	hsa-miR-4652-3p	CLIP-seq
MIRT1984302	hsa-miR-4653-3p	CLIP-seq
MIRT1984303	hsa-miR-4658	CLIP-seq
MIRT1984304	hsa-miR-4663	CLIP-seq
MIRT959738	hsa-miR-4698	CLIP-seq
MIRT1984305	hsa-miR-4712-3p	CLIP-seq
MIRT959740	hsa-miR-4722-5p	CLIP-seq
MIRT1984306	hsa-miR-4734	CLIP-seq
MIRT1984307	hsa-miR-4753-3p	CLIP-seq
MIRT1984308	hsa-miR-4767	CLIP-seq
MIRT1984309	hsa-miR-485-3p	CLIP-seq
MIRT959749	hsa-miR-492	CLIP-seq
MIRT959751	hsa-miR-505	CLIP-seq
MIRT959754	hsa-miR-539	CLIP-seq
MIRT1984310	hsa-miR-544	CLIP-seq
MIRT1984311	hsa-miR-548ac	CLIP-seq
MIRT1984312	hsa-miR-548ae	CLIP-seq
MIRT1984313	hsa-miR-548aj	CLIP-seq
MIRT1984314	hsa-miR-548am	CLIP-seq
MIRT1984315	hsa-miR-548d-3p	CLIP-seq
MIRT959755	hsa-miR-548p	CLIP-seq
MIRT1984316	hsa-miR-548x	CLIP-seq
MIRT1984317	hsa-miR-548z	CLIP-seq
MIRT959756	hsa-miR-550a	CLIP-seq
MIRT1984318	hsa-miR-561	CLIP-seq
MIRT1984319	hsa-miR-574-5p	CLIP-seq
MIRT959757	hsa-miR-580	CLIP-seq
MIRT1984320	hsa-miR-603	CLIP-seq
MIRT959759	hsa-miR-644	CLIP-seq
MIRT959760	hsa-miR-661	CLIP-seq
MIRT1984321	hsa-miR-758	CLIP-seq
MIRT1984322	hsa-miR-759	CLIP-seq
MIRT959761	hsa-miR-875-3p	CLIP-seq
MIRT959680	hsa-miR-1304	CLIP-seq
MIRT2219403	hsa-miR-1305	CLIP-seq
MIRT1984288	hsa-miR-197	CLIP-seq
MIRT2219404	hsa-miR-219-1-3p	CLIP-seq
MIRT2219405	hsa-miR-2278	CLIP-seq
MIRT2219406	hsa-miR-3126-5p	CLIP-seq
MIRT2219407	hsa-miR-3133	CLIP-seq
MIRT959699	hsa-miR-3168	CLIP-seq
MIRT959700	hsa-miR-3199	CLIP-seq
MIRT2219408	hsa-miR-324-5p	CLIP-seq
MIRT1984290	hsa-miR-330-3p	CLIP-seq
MIRT2219409	hsa-miR-342-5p	CLIP-seq
MIRT2219410	hsa-miR-3613-5p	CLIP-seq
MIRT2219411	hsa-miR-3662	CLIP-seq
MIRT1984294	hsa-miR-377	CLIP-seq
MIRT959722	hsa-miR-4277	CLIP-seq
MIRT959724	hsa-miR-4421	CLIP-seq
MIRT1984299	hsa-miR-4422	CLIP-seq
MIRT2219412	hsa-miR-4515	CLIP-seq
MIRT2219413	hsa-miR-4520a-3p	CLIP-seq
MIRT2219414	hsa-miR-4520b-3p	CLIP-seq
MIRT2219415	hsa-miR-4529-3p	CLIP-seq
MIRT2219416	hsa-miR-4651	CLIP-seq
MIRT2219417	hsa-miR-4664-5p	CLIP-seq
MIRT959738	hsa-miR-4698	CLIP-seq
MIRT2219418	hsa-miR-4704-5p	CLIP-seq
MIRT959751	hsa-miR-505	CLIP-seq
MIRT2219419	hsa-miR-520a-5p	CLIP-seq
MIRT2219420	hsa-miR-525-5p	CLIP-seq
MIRT2219421	hsa-miR-571	CLIP-seq
MIRT2219422	hsa-miR-577	CLIP-seq
MIRT2219423	hsa-miR-579	CLIP-seq
MIRT2219424	hsa-miR-608	CLIP-seq
MIRT2219425	hsa-miR-653	CLIP-seq
MIRT2219426	hsa-miR-664	CLIP-seq
MIRT2219406	hsa-miR-3126-5p	CLIP-seq
MIRT2219409	hsa-miR-342-5p	CLIP-seq
MIRT2219416	hsa-miR-4651	CLIP-seq
MIRT2219417	hsa-miR-4664-5p	CLIP-seq
MIRT2219424	hsa-miR-608	CLIP-seq
MIRT1984281	hsa-miR-1206	CLIP-seq
MIRT959678	hsa-miR-1254	CLIP-seq
MIRT1984285	hsa-miR-133a	CLIP-seq
MIRT1984286	hsa-miR-133b	CLIP-seq
MIRT1984288	hsa-miR-197	CLIP-seq
MIRT2522713	hsa-miR-31	CLIP-seq
MIRT959692	hsa-miR-3116	CLIP-seq
MIRT2219406	hsa-miR-3126-5p	CLIP-seq
MIRT959697	hsa-miR-3152-3p	CLIP-seq
MIRT959699	hsa-miR-3168	CLIP-seq
MIRT959700	hsa-miR-3199	CLIP-seq
MIRT1984293	hsa-miR-3659	CLIP-seq
MIRT959712	hsa-miR-378g	CLIP-seq
MIRT1984296	hsa-miR-3977	CLIP-seq
MIRT1984298	hsa-miR-4255	CLIP-seq
MIRT959722	hsa-miR-4277	CLIP-seq
MIRT1984299	hsa-miR-4422	CLIP-seq
MIRT2219412	hsa-miR-4515	CLIP-seq
MIRT1984303	hsa-miR-4658	CLIP-seq
MIRT1984304	hsa-miR-4663	CLIP-seq
MIRT2522714	hsa-miR-4738-3p	CLIP-seq
MIRT1984309	hsa-miR-485-3p	CLIP-seq
MIRT2219419	hsa-miR-520a-5p	CLIP-seq
MIRT2219420	hsa-miR-525-5p	CLIP-seq
MIRT1984310	hsa-miR-544	CLIP-seq
MIRT959755	hsa-miR-548p	CLIP-seq
MIRT959756	hsa-miR-550a	CLIP-seq
MIRT1984319	hsa-miR-574-5p	CLIP-seq
MIRT959760	hsa-miR-661	CLIP-seq
MIRT1984322	hsa-miR-759	CLIP-seq
MIRT959762	hsa-miR-877	CLIP-seq
MIRT2522715	hsa-miR-9	CLIP-seq
MIRT1984281	hsa-miR-1206	CLIP-seq
MIRT2219403	hsa-miR-1305	CLIP-seq
MIRT2679886	hsa-miR-205	CLIP-seq
MIRT2522713	hsa-miR-31	CLIP-seq
MIRT2679887	hsa-miR-3144-5p	CLIP-seq
MIRT959697	hsa-miR-3152-3p	CLIP-seq
MIRT2679888	hsa-miR-3191	CLIP-seq
MIRT1984289	hsa-miR-3194-3p	CLIP-seq
MIRT2679889	hsa-miR-326	CLIP-seq
MIRT2679890	hsa-miR-330-5p	CLIP-seq
MIRT1984293	hsa-miR-3659	CLIP-seq
MIRT2679891	hsa-miR-3661	CLIP-seq
MIRT1984298	hsa-miR-4255	CLIP-seq
MIRT1984299	hsa-miR-4422	CLIP-seq
MIRT2679892	hsa-miR-4639-3p	CLIP-seq
MIRT2679893	hsa-miR-4652-5p	CLIP-seq
MIRT1984303	hsa-miR-4658	CLIP-seq
MIRT1984304	hsa-miR-4663	CLIP-seq
MIRT959737	hsa-miR-4667-5p	CLIP-seq
MIRT959739	hsa-miR-4700-5p	CLIP-seq
MIRT1984309	hsa-miR-485-3p	CLIP-seq
MIRT1984310	hsa-miR-544	CLIP-seq
MIRT1984319	hsa-miR-574-5p	CLIP-seq
MIRT2679894	hsa-miR-631	CLIP-seq
MIRT959758	hsa-miR-637	CLIP-seq
MIRT1984322	hsa-miR-759	CLIP-seq
MIRT959762	hsa-miR-877	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ZFP36	Activation	15158469

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000512	Process	LncRNA-mediated post-transcriptional gene silencing	IEA
GO:0000932	Component	P-body	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	19561594, 21613615
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0003729	Function	MRNA binding	IEA
GO:0003729	Function	MRNA binding	TAS	10660597
GO:0003730	Function	MRNA 3'-UTR binding	IDA	26595526
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	ISS
GO:0005515	Function	Protein binding	IPI	14731398, 17632515, 17932509, 18191643, 19322201, 25416956, 25959826, 26489465, 27616329, 27974568, 31358969, 32814053
GO:0005634	Component	Nucleus	IDA	14517288
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	17632515
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	14517288, 19029303
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	17632515
GO:0005829	Component	Cytosol	TAS
GO:0006606	Process	Protein import into nucleus	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016441	Process	Post-transcriptional gene silencing	IEA
GO:0016528	Component	Sarcoplasm	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	14517288
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032930	Process	Positive regulation of superoxide anion generation	IEA
GO:0035198	Function	MiRNA binding	IDA	26595526
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	8626503, 14517288, 14731398, 16126846, 23056314, 23519412, 26489465
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	17632515
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0045727	Process	Positive regulation of translation	IDA	21613615
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045772	Process	Positive regulation of autophagosome size	IEA
GO:0048255	Process	MRNA stabilization	IDA	21613615
GO:0048255	Process	MRNA stabilization	IDA	31358969
GO:0048255	Process	MRNA stabilization	IEA
GO:0048255	Process	MRNA stabilization	IMP	19029303
GO:0051260	Process	Protein homooligomerization	IDA	26595526
GO:0060965	Process	Negative regulation of miRNA-mediated gene silencing	IMP	26595526
GO:0061157	Process	MRNA destabilization	IEA
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	14517288, 26489465, 29180010
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IEA
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IMP	19029303
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106222	Function	LncRNA binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:1990904	Component	Ribonucleoprotein complex	ISS
GO:2000036	Process	Regulation of stem cell population maintenance	IEA
GO:2000036	Process	Regulation of stem cell population maintenance	ISS

Other IDs

• MIM: 603466
• HGNC: 3312
• e!Ensembl: ENSG00000066044

Protein

• UniProt ID: Q15717
• Protein name: ELAV-like protein 1 (Hu-antigen R) (HuR)
• Protein function: RNA-binding protein that binds to the 3'-UTR region of mRNAs and increases their stability (PubMed:14517288, PubMed:18285462, PubMed:31358969). Involved in embryonic stem cell (ESC) differentiation: preferentially binds mRNAs that are not methyl
• PDB: 3HI9, 4ED5, 4EGL, 4FXV, 5SZW, 6G2K, 6GC5, 6GD1, 6GD2, 6GD3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	22 → 92	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	108 → 176	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	246 → 316	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Detected in brain, liver, thymus and muscle. {ECO:0000269|PubMed:8626503}.
• Sequence:

  MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHS
  LGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQK
  DVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIT
  VKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNA
  SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM
  AIASLNGYRLGDKILQVSFKTNKSHK

• Sequence length: 326

Pathways

KEGG:

AMPK signaling pathway
IL-17 signaling pathway

Reactome:

HuR (ELAVL1) binds and stabilizes mRNA
mRNA Splicing - Major Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE REMODELING DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30551620		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18056170, 19208339, 25010987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	19009247		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19828005		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18094611		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19208339		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11280780		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31755389	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25239623		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	29285201		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17599736	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25678110	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15824116	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	17531241		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20626035, 22907529, 27764700, 30652415		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16914445, 18641687, 18769129, 19777567, 19875930, 20370918, 20974809, 21480233, 21503589, 22436134, 22907529, 23028944, 23605320, 24692066, 24954509, 25383675, 25830480, 25913416, 26553968, 28637868, 28808873, 36647722, 37348024, 37592296, 37828756, 37848981	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19010922	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19208339, 21161467, 21480233, 21572400, 22436134, 23259573, 23605320, 24954509, 25750985, 27075229, 27542231, 31089242, 31940247, 35721888, 36849492	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29619127		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21480233	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	38256026	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10964780, 23814050, 24719890, 28035067, 30602494, 34409736, 37021545	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21480233	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	20519042		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28572169		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19487279, 22785201, 26675757, 27053682, 27893535, 30670910, 35703534, 37685961	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21161467, 30770799	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21572400, 34112238, 36513874	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11280780		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29492748		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25841271, 29471005		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	14562043		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16799479	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19208339		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28242812, 29351796, 29471005, 29931370		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11733561, 16799479, 18094611, 20421296, 22544606, 23880304, 24865968, 28968471, 29386086, 34158864, 35130122, 35218185, 35721888, 36224588, 36380064, 36727289, 36849492	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	BEFREE	22907529		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26898797		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	36477660	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21744426		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32724827	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	16820934		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27328642		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35493610	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27964927		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20889954, 38256026	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20889954		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20889954		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	20889954	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23873103	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23873103, 31651222	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28231690	Inhibit	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30081711		★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	28445960	Inhibit	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31752906		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	31752906	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11280780		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22258704, 25803745, 26874904, 30991885, 35871232	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11280780		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22829587, 23525947, 24815461, 25803745, 26874904, 28790173, 35285415	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24815461, 27166258, 28790173		★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	BEFREE	31369403		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26898797		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21480233	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	26898797		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	15824116	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	36477660	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	20587520		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16914445, 29606096	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21795698, 23115237, 26325091, 26387536, 35346905	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27458111		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	32614269	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	32614269	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	19124115		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	22562506		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31463702		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	30770799	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28269752	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35986311	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	31467122		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31467122		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21795698		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24719890, 25841271, 31438961		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21572400, 26494555, 28855578, 34605863, 37055376	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18505733, 36075396	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18505733		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23259573, 23873103, 25383675, 31940247	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25252849	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29576851	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22907529, 27764700, 30652415		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28572169		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21795698		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19828005, 21152064		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26764246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31089242		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11280780, 21935886, 26640230, 26764246, 27197193, 27764700, 28790173, 29452455, 29560787, 31089242, 31358321		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25841271, 29471005		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15328200, 16912169, 18769129, 19010922		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19010922		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11280780		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12096926, 29393978		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26970271, 35970041	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35722625	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	18317686		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18317686		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	18831511		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	18831511	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	33417721	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26690054, 28630277	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	24534848	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20332213, 21795698, 27941877, 30449075	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33530159	Associate	★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	29149290	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	15824116	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23861541		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32370736, 37215987	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18056170, 25112469, 25252849, 27058892, 27738870, 27941877, 28231690, 28790173, 28808873, 29351796		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	31467122		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24796672, 29758295		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	28630277		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	30289952	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30182452, 32266933, 36053455	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	27075229, 33894314	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23394580, 26943573, 27075229, 28365935, 33894314, 35624501, 37684273, 39809219	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19828005		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19487279, 21152064, 22785201, 23807417, 26362587, 26387536, 26675757, 27053682, 27893535, 30670910	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29149290		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29149290, 36593912	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28242812		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29393507		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26764246		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21971048, 27102850, 27140699, 34335955, 35562348, 37647111, 39265220	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27458111		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29866111, 35011584	Associate	★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	22907529		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28196122, 28407018		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16820934, 17599736		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16820934		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	27575817	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	27575817	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18705402		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	34662337	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	15824116	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18027256		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20332213, 21795698, 27941336, 28435450	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21795698		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16474375, 31940247, 33824303, 33879018	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18824170		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	35938548	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35352515	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31089242		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	26498465	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31089242		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27542231, 31089242, 35030041	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27588488	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35711895	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36293387	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	23259573	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20007147, 22841487, 26819413, 28080204, 32515533, 32757457, 35595754	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	20889954	Inhibit	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	25678110, 26325091, 30214075	Associate	★☆☆☆☆ Found in Text Mining only