ELAVL2 (ELAV like RNA binding protein 2)

Gene

• Entrez ID: 1993
• Gene name: ELAV like RNA binding protein 2
• Gene symbol: ELAVL2
• Synonyms (NCBI Gene): HEL-N1, HELN1, HUB
• Chromosome: 9
• Chromosome location: 9p21.3
• Summary: In humans, the ELAV like RNA binding protein gene family has four members (ELAVL1-4). ELAVL RNA binding proteins recognize AU-rich elements in the 3` UTRs of gene transcripts and thereby regulate gene expression post-transcriptionally. The protein encoded

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024181	hsa-miR-221-3p	Sequencing	20371350
MIRT027342	hsa-miR-101-3p	Sequencing	20371350
MIRT030264	hsa-miR-26b-5p	Sequencing	20371350
MIRT053464	hsa-miR-200c-3p	Microarray	23807165
MIRT558167	hsa-miR-375	PAR-CLIP	21572407
MIRT558166	hsa-miR-548l	PAR-CLIP	21572407
MIRT558165	hsa-miR-4272	PAR-CLIP	21572407
MIRT558164	hsa-miR-8063	PAR-CLIP	21572407
MIRT558163	hsa-miR-4698	PAR-CLIP	21572407
MIRT558162	hsa-miR-3973	PAR-CLIP	21572407
MIRT558161	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT558160	hsa-miR-520h	PAR-CLIP	21572407
MIRT558159	hsa-miR-665	PAR-CLIP	21572407
MIRT558158	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT558157	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT558156	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT558155	hsa-miR-371a-5p	PAR-CLIP	21572407
MIRT558154	hsa-miR-372-5p	PAR-CLIP	21572407
MIRT558153	hsa-miR-513c-5p	PAR-CLIP	21572407
MIRT558152	hsa-miR-514b-5p	PAR-CLIP	21572407
MIRT558151	hsa-miR-6739-3p	PAR-CLIP	21572407
MIRT537766	hsa-miR-501-3p	PAR-CLIP	22012620
MIRT537765	hsa-miR-502-3p	PAR-CLIP	22012620
MIRT537764	hsa-miR-541-5p	PAR-CLIP	22012620
MIRT537763	hsa-miR-4712-3p	PAR-CLIP	22012620
MIRT537762	hsa-miR-4521	PAR-CLIP	22012620
MIRT537761	hsa-miR-539-5p	PAR-CLIP	22012620
MIRT537760	hsa-miR-6804-3p	PAR-CLIP	22012620
MIRT537759	hsa-miR-3201	PAR-CLIP	22012620
MIRT537758	hsa-miR-4791	PAR-CLIP	22012620
MIRT537757	hsa-miR-500a-3p	PAR-CLIP	22012620
MIRT537756	hsa-miR-4639-5p	PAR-CLIP	22012620
MIRT537755	hsa-miR-302e	PAR-CLIP	22012620
MIRT537754	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT537753	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT537752	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT537751	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT537750	hsa-miR-520b	PAR-CLIP	22012620
MIRT537749	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT537748	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT537747	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT537746	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT537745	hsa-miR-520e	PAR-CLIP	22012620
MIRT537744	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT537743	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT537742	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT537741	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT537740	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT537739	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT537738	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT537737	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT537736	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT537735	hsa-miR-200a-3p	PAR-CLIP	22012620
MIRT537734	hsa-miR-141-3p	PAR-CLIP	22012620
MIRT537733	hsa-miR-3609	PAR-CLIP	22012620
MIRT537732	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT537731	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT537730	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT537729	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT537728	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT537727	hsa-miR-3607-3p	PAR-CLIP	22012620
MIRT537726	hsa-miR-3194-3p	PAR-CLIP	22012620
MIRT537725	hsa-miR-4477a	PAR-CLIP	22012620
MIRT537724	hsa-miR-5691	PAR-CLIP	22012620
MIRT537723	hsa-miR-6805-3p	PAR-CLIP	22012620
MIRT727780	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT030264	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT558167	hsa-miR-375	PAR-CLIP	21572407
MIRT558166	hsa-miR-548l	PAR-CLIP	21572407
MIRT558165	hsa-miR-4272	PAR-CLIP	21572407
MIRT558164	hsa-miR-8063	PAR-CLIP	21572407
MIRT558163	hsa-miR-4698	PAR-CLIP	21572407
MIRT558162	hsa-miR-3973	PAR-CLIP	21572407
MIRT558161	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT558160	hsa-miR-520h	PAR-CLIP	21572407
MIRT558159	hsa-miR-665	PAR-CLIP	21572407
MIRT558158	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT558157	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT558156	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT558155	hsa-miR-371a-5p	PAR-CLIP	21572407
MIRT558154	hsa-miR-372-5p	PAR-CLIP	21572407
MIRT558153	hsa-miR-513c-5p	PAR-CLIP	21572407
MIRT558152	hsa-miR-514b-5p	PAR-CLIP	21572407
MIRT558151	hsa-miR-6739-3p	PAR-CLIP	21572407
MIRT537766	hsa-miR-501-3p	PAR-CLIP	22012620
MIRT537765	hsa-miR-502-3p	PAR-CLIP	22012620
MIRT537764	hsa-miR-541-5p	PAR-CLIP	22012620
MIRT537763	hsa-miR-4712-3p	PAR-CLIP	22012620
MIRT537762	hsa-miR-4521	PAR-CLIP	22012620
MIRT537761	hsa-miR-539-5p	PAR-CLIP	22012620
MIRT537760	hsa-miR-6804-3p	PAR-CLIP	22012620
MIRT537759	hsa-miR-3201	PAR-CLIP	22012620
MIRT537758	hsa-miR-4791	PAR-CLIP	22012620
MIRT537757	hsa-miR-500a-3p	PAR-CLIP	22012620
MIRT537756	hsa-miR-4639-5p	PAR-CLIP	22012620
MIRT537755	hsa-miR-302e	PAR-CLIP	22012620
MIRT537754	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT537753	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT537752	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT537751	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT537750	hsa-miR-520b	PAR-CLIP	22012620
MIRT537749	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT537748	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT537747	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT537746	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT537745	hsa-miR-520e	PAR-CLIP	22012620
MIRT537744	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT537743	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT537742	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT537741	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT537740	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT537739	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT537738	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT537737	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT537736	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT537735	hsa-miR-200a-3p	PAR-CLIP	22012620
MIRT537734	hsa-miR-141-3p	PAR-CLIP	22012620
MIRT537733	hsa-miR-3609	PAR-CLIP	22012620
MIRT537732	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT537731	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT537730	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT537729	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT537728	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT537727	hsa-miR-3607-3p	PAR-CLIP	22012620
MIRT537726	hsa-miR-3194-3p	PAR-CLIP	22012620
MIRT537725	hsa-miR-4477a	PAR-CLIP	22012620
MIRT537724	hsa-miR-5691	PAR-CLIP	22012620
MIRT537723	hsa-miR-6805-3p	PAR-CLIP	22012620
MIRT959764	hsa-miR-106a	CLIP-seq
MIRT959765	hsa-miR-106b	CLIP-seq
MIRT959766	hsa-miR-141	CLIP-seq
MIRT959767	hsa-miR-17	CLIP-seq
MIRT959768	hsa-miR-200a	CLIP-seq
MIRT959769	hsa-miR-20a	CLIP-seq
MIRT959770	hsa-miR-20b	CLIP-seq
MIRT959771	hsa-miR-3646	CLIP-seq
MIRT959772	hsa-miR-3662	CLIP-seq
MIRT959773	hsa-miR-3679-3p	CLIP-seq
MIRT959774	hsa-miR-4290	CLIP-seq
MIRT959775	hsa-miR-4519	CLIP-seq
MIRT959776	hsa-miR-4530	CLIP-seq
MIRT959777	hsa-miR-519d	CLIP-seq
MIRT959778	hsa-miR-548ah	CLIP-seq
MIRT959779	hsa-miR-634	CLIP-seq
MIRT959780	hsa-miR-93	CLIP-seq
MIRT2219427	hsa-miR-144	CLIP-seq
MIRT2448779	hsa-miR-1257	CLIP-seq
MIRT2448780	hsa-miR-576-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	TAS	8158249
GO:0005515	Function	Protein binding	IPI	17289661, 32814053, 36950384
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	8158249
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 601673
• HGNC: 3313
• e!Ensembl: ENSG00000107105

Protein

• UniProt ID: Q12926
• Protein name: ELAV-like protein 2 (ELAV-like neuronal protein 1) (Hu-antigen B) (HuB) (Nervous system-specific RNA-binding protein Hel-N1)
• Protein function: RNA-binding protein that binds to the 3' untranslated region (3'UTR) of target mRNAs (By similarity). Seems to recognize a GAAA motif (By similarity). Can bind to its own 3'UTR, the FOS 3'UTR and the ID 3'UTR (By similarity). {ECO:0000250|UniPro
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	41 → 111	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	127 → 195	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	278 → 348	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Brain; neural-specific.
• Sequence:

  METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLFG
  SIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSA
  SIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAE
  EAIKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQSPNRRYPGPLAQQAQRFRLD
  NLLNMAYGVKRFSPMTIDGMTSLAGINIPGHPGTGWCIFVYNLAPDADESILWQMFGPFG
  AVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKTHKA

• Sequence length: 359

Pathways

Reactome:

mRNA Splicing - Major Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUDITORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ELAVL2-related disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31612481		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29805592, 30237740, 30920015, 31127628, 31333911, 31423238, 31423239, 31611968		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	31211595		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	30475060		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	30886771		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	31289514, 9988134		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	31698053		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30946360		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30158955, 30519354, 31516579, 31572440		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33506048, 34326892, 34966527, 37549144, 38176925	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30774662, 31081124		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31020690		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	31239775		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31232492, 31311829		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31553078, 31608184		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	36818541, 37684281	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	37175670	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30158955, 30519354, 31516579, 31572440		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	30574098		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29685964, 31043156, 31449494, 31487691		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34435051	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37773661	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30304558		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29685964, 31043156, 31449494, 31487691		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	37240358	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30760287		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27260404	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26399424, 27260404, 31511657, 31743624		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	27260404		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	27260404	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31824497		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25239644, 28693282, 29029427, 29234286, 30533316, 30927274, 31182759, 31681575		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25239644, 29994068, 30140156, 30265984, 30506958, 30646630, 30707565, 30810442, 31037764, 31285391, 31423162, 31428132, 31709182, 31758680, 31777591		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25239644, 31758680, 34055036, 34675265, 34755126, 35037689, 36293493, 37569854, 37713876	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29992138, 30696738, 32351322, 33376723, 35774271, 36708238	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31822116, 32200387, 33376723, 34337056, 34737677, 36479313, 37089050, 39179766	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25239644, 28693282, 29029427, 29234286, 30533316, 30927274, 31182759, 31681575		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25239644, 28335719, 30542454, 31423239, 31516588, 31611952, 31726467, 9393760		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37347115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29993891, 29994068, 30970615, 31135262, 31729978		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33015184, 36042172	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34975885	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	36304068	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	31809599		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	34248836	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30760287, 31020690		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31289514, 31820345, 9988134		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31177590		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	32011476	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	31423244		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	31663162		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31419078		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	30922293		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31811111		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	31772671		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35966251	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30643458		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35774271	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28794688, 29187879, 30475060, 30672027, 31495599, 31724326		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29209625, 31781593, 32090086, 32351322, 34070979, 35774271, 36798788, 38203779	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31177590, 31612054, 31632083, 31638221		★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	BEFREE	30937957		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30485493, 31850068		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29720944, 30008862, 30417363, 30988807, 31672930, 31697440, 31746384, 31788359, 31839812		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31245869, 31689620		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31886261	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	36123899	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31258663		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30506715, 30548602, 30834598, 31139654, 31572500		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30489189		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30864711	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	39478498	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31170441		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35477946, 37986309	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34830198, 37935955	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31124977		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28855812, 31088900, 31449493		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33887734, 34735495, 35721731, 35991124, 36553678, 36896170, 37656997	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30485525, 30761531		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31827551		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32294661, 35154512	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31331250		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	31751374		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	26339408	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	31807183		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	31807183		★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30122983, 31781484, 31807178		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26366417	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29503661		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31258675		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	38164831	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30970615		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32756534, 36569220	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31950035, 33345608, 36238478	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30410352, 31516570, 31788075		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30923657		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	30877790		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31127138		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28990066		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	35872944	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29866745, 30655863, 30867991, 31611967, 31617063, 31788092, 9988134		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31674730, 32667033, 33449451, 33803224, 35328072, 36397358	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29866745, 30655863, 30867991, 31611967, 31617063, 31788092, 9988134		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	34840971	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30847302, 31452775		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	26339408	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30485493, 31850068		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36859608	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33376723	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32888289	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	36483920	Associate	★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	30298691		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31059139		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38154101	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31177264		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	39712025	Associate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	31663162		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	31124977, 34545328	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	31124977		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33619226	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36701711	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31310372		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31452767		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28947976, 29443924, 29962817, 30628708, 30719129, 30746803, 31293639, 31392101, 31611988, 31698564, 31746405, 31754223, 31811111, 31822116		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31811111		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	36773569	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25239644, 32596300, 36395727, 39331864, 39511334	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	9393760		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35757684, 35858908	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31616519		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31592160		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35965624	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085, 30718901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	31275757, 31428135, 31434867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30847302, 31452775		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25239644, 29994068, 30140156, 30265984, 30506958, 30646630, 30707565, 30810442, 31037764, 31081218, 31285391, 31423162, 31428132, 31709182, 31758680, 31777591		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31781484, 31807178		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25239644, 28335719, 30542454, 31423239, 31516588, 31611952, 31726467, 9393760		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29993891, 29994068, 31135262, 31729978		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28860807, 31061236, 31281439, 31289489, 31297881, 31706267		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29066912, 29887958, 30867653, 31031850, 31116024, 31306099, 31533842, 31637138, 31746380, 31795990		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25239644, 29050278, 29764446, 30002985, 30323620, 30568862, 30805585, 31308482, 31571913, 31638362		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25239644, 28693282, 29029427, 29234286, 30533316, 30927274, 31134129, 31182759, 31681575		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28335719, 28849390, 29066912, 29088818, 29391900, 29666752, 29991691, 30506958, 30568862, 30652311, 30672027, 30887286, 30904494, 31020690, 31023966, 31134129, 31304688, 31412643, 31602219, 31637138, 31733575, 31788078, 31788113, 31799078, 31802101		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30643458		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31289514, 9988134		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	31557882		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28030792, 31620197, 31788081		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30489189		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30824724		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37684281	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38292759	Associate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30861201		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30671382		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	38433435	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29503661		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	38218802	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	31390219		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	38228864	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	32047813	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28969025, 31289570, 31516577, 31770211		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29137373, 29234286, 31127628, 31233342, 31333788, 31672930, 31737652, 31803233, 31839674, 31839812, 9393760, 9421353, 9815574, 9988134		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	35991124	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	9815574		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28899360		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	31557882		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28219123, 29769539		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29731852, 30349363, 31127628, 31426680, 31692035, 31805030, 9393760		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31300714		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32832544, 38292759	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31139654		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30834083, 30867698, 30906443		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	30680001, 30906457		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31037778		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34596127	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	30519094		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29993891, 29994068, 31135262, 31729978		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28365935, 32180586, 33004058, 35047055	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28860807, 31061236, 31281439, 31289489, 31297881, 31706267, 31724100		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31731384		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36522691	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	28427189		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31332712		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28899360, 30538480		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33791366	Associate	★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	28810559		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37986309, 38218802	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29066912, 29887958, 30867653, 31031850, 31116024, 31306099, 31533842, 31637138, 31746380, 31795990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26890304, 34806485, 36284990	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36035209	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	37935955	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33816621, 36072642	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31419078, 35637927, 36475041	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29578145		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32443297, 34187205, 37179305	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30834598, 31011897, 31788092		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21674006, 31704949, 31715283		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21674006		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	37552420	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	30859572		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	33557955	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	31190870, 31545448		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29257295		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30719767		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	18607064		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	CTD_human_DG	22941189		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	8619556, 9291425, 9393760, 9585817		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	18607064	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25239644, 31139019, 31285951, 31485619		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31517839, 31562292	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31127628, 31423239, 31612029		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28490889, 30871913, 30900950, 31304688, 31422208, 31460782, 31496804		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31517839		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30485493		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25239644, 29050278, 29764446, 30002985, 30323620, 30568862, 30805585, 31308482, 31571913, 31638362		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32058995, 35328635, 37752199	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	38154101	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	33025856	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30140156, 31297036, 31423181		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36157217	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31214045, 31258663		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31434867		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36472061	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	31558111		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36879084	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	36483920	Associate	★☆☆☆☆ Found in Text Mining only