Gene Gene information from NCBI Gene database.
Entrez ID 1983
Gene name Eukaryotic translation initiation factor 5
Gene symbol EIF5
Synonyms (NCBI Gene)
EIF-5EIF-5A
Chromosome 14
Chromosome location 14q32.32
Summary Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal init
miRNA miRNA information provided by mirtarbase database.
902
miRTarBase ID miRNA Experiments Reference
MIRT030925 hsa-miR-21-5p Microarray 18591254
MIRT031742 hsa-miR-16-5p Proteomics 18668040
MIRT045909 hsa-miR-125b-5p CLASH 23622248
MIRT045098 hsa-miR-186-5p CLASH 23622248
MIRT405774 hsa-miR-8066 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001732 Process Formation of cytoplasmic translation initiation complex IBA
GO:0003723 Function RNA binding HDA 22681889
GO:0003743 Function Translation initiation factor activity IBA
GO:0003743 Function Translation initiation factor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601710 3299 ENSG00000100664
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P55010
Protein name Eukaryotic translation initiation factor 5 (eIF-5)
Protein function Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon (PubMed:11166181, PubMed:22813744, PubMed:24319994). In this complex, acts as
PDB 2E9H , 2G2K , 2IU1 , 8OZ0 , 8PJ2 , 8PJ3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01873 eIF-5_eIF-2B 6 128 Domain found in IF2B/IF5 Family
PF02020 W2 310 392 eIF4-gamma/eIF5/eIF2-epsilon Family
Sequence
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCE
LGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGN
SCKACGYR
GMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPP
PPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERV
NILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF
LRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASK
KYVSKELAKEIRVKAEPFIKWLKEAEEESSGG
EEEDEDENIEVVYSKAASVPKVETVKSD
NKDDDIDIDAI
Sequence length 431
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA CTD, Disgenet, GWAS catalog
CTD, Disgenet, GWAS catalog
CTD, Disgenet, GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 12687616
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 26512942 Associate
★☆☆☆☆
Found in Text Mining only
Ataxia Ataxia Pubtator 12707859 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Male Male breast neoplasms Pubtator 27986751 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of Male Breast Breast Carcinoma, male BEFREE 27986751
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 11325856
★☆☆☆☆
Found in Text Mining only
Central Nervous System Diseases Central nervous system disease Pubtator 12707859 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 29254159
★☆☆☆☆
Found in Text Mining only
Endometrial Carcinoma Endometrial carcinoma BEFREE 31817792
★☆☆☆☆
Found in Text Mining only
Endometrial Neoplasms Endometrial neoplasm Pubtator 31817792 Associate
★☆☆☆☆
Found in Text Mining only