Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1981
Gene name	Eukaryotic translation initiation factor 4 gamma 1
Gene symbol	EIF4G1
Synonyms (NCBI Gene)	EIF-4G1EIF4FEIF4GEIF4GIP220PARK18
Chromosome	3
Chromosome location	3q27.1
Summary	The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition o

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs111290936	C>T	Risk-factor	Missense variant, coding sequence variant
rs112176450	G>A,T	Risk-factor	Missense variant, coding sequence variant

252

Show/Hide all (252)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023744	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT025464	hsa-miR-34a-5p	Sequencing	20371350
MIRT027930	hsa-miR-96-5p	Sequencing	20371350
MIRT031636	hsa-miR-16-5p	Proteomics	18668040
MIRT044854	hsa-miR-320a	CLASH	23622248
MIRT040339	hsa-miR-615-3p	CLASH	23622248
MIRT037839	hsa-miR-455-3p	CLASH	23622248
MIRT037651	hsa-miR-744-5p	CLASH	23622248
MIRT052684	hsa-miR-1260b	CLASH	23622248
MIRT437405	hsa-miR-520c-3p	BL	24497838
MIRT440735	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440735	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT958717	hsa-miR-1324	CLIP-seq
MIRT958718	hsa-miR-3127-3p	CLIP-seq
MIRT958719	hsa-miR-3131	CLIP-seq
MIRT958720	hsa-miR-3157-5p	CLIP-seq
MIRT958721	hsa-miR-361-3p	CLIP-seq
MIRT958722	hsa-miR-3690	CLIP-seq
MIRT958723	hsa-miR-3942-3p	CLIP-seq
MIRT958724	hsa-miR-3945	CLIP-seq
MIRT958725	hsa-miR-4254	CLIP-seq
MIRT958726	hsa-miR-4269	CLIP-seq
MIRT958727	hsa-miR-4313	CLIP-seq
MIRT958728	hsa-miR-4323	CLIP-seq
MIRT958729	hsa-miR-4438	CLIP-seq
MIRT958730	hsa-miR-4452	CLIP-seq
MIRT958731	hsa-miR-4514	CLIP-seq
MIRT958732	hsa-miR-4530	CLIP-seq
MIRT958733	hsa-miR-4632	CLIP-seq
MIRT958734	hsa-miR-4645-5p	CLIP-seq
MIRT958735	hsa-miR-4673	CLIP-seq
MIRT958736	hsa-miR-4691-3p	CLIP-seq
MIRT958737	hsa-miR-4692	CLIP-seq
MIRT958738	hsa-miR-4693-3p	CLIP-seq
MIRT958739	hsa-miR-4715-3p	CLIP-seq
MIRT958740	hsa-miR-4722-3p	CLIP-seq
MIRT958741	hsa-miR-4731-5p	CLIP-seq
MIRT958742	hsa-miR-4740-3p	CLIP-seq
MIRT958743	hsa-miR-4760-3p	CLIP-seq
MIRT958744	hsa-miR-4765	CLIP-seq
MIRT958745	hsa-miR-4793-5p	CLIP-seq
MIRT958746	hsa-miR-486-3p	CLIP-seq
MIRT958747	hsa-miR-499-3p	CLIP-seq
MIRT958748	hsa-miR-499a-3p	CLIP-seq
MIRT958749	hsa-miR-503	CLIP-seq
MIRT958750	hsa-miR-5095	CLIP-seq
MIRT958751	hsa-miR-611	CLIP-seq
MIRT958752	hsa-miR-642b	CLIP-seq
MIRT958753	hsa-miR-1909	CLIP-seq
MIRT958754	hsa-miR-214	CLIP-seq
MIRT958719	hsa-miR-3131	CLIP-seq
MIRT958721	hsa-miR-361-3p	CLIP-seq
MIRT958755	hsa-miR-3619-5p	CLIP-seq
MIRT958722	hsa-miR-3690	CLIP-seq
MIRT958724	hsa-miR-3945	CLIP-seq
MIRT958725	hsa-miR-4254	CLIP-seq
MIRT958727	hsa-miR-4313	CLIP-seq
MIRT958756	hsa-miR-4492	CLIP-seq
MIRT958757	hsa-miR-4498	CLIP-seq
MIRT958758	hsa-miR-4505	CLIP-seq
MIRT958732	hsa-miR-4530	CLIP-seq
MIRT958734	hsa-miR-4645-5p	CLIP-seq
MIRT958759	hsa-miR-4651	CLIP-seq
MIRT958735	hsa-miR-4673	CLIP-seq
MIRT958738	hsa-miR-4693-3p	CLIP-seq
MIRT958741	hsa-miR-4731-5p	CLIP-seq
MIRT958742	hsa-miR-4740-3p	CLIP-seq
MIRT958760	hsa-miR-4742-5p	CLIP-seq
MIRT958744	hsa-miR-4765	CLIP-seq
MIRT958745	hsa-miR-4793-5p	CLIP-seq
MIRT958746	hsa-miR-486-3p	CLIP-seq
MIRT958749	hsa-miR-503	CLIP-seq
MIRT958761	hsa-miR-608	CLIP-seq
MIRT958751	hsa-miR-611	CLIP-seq
MIRT958762	hsa-miR-761	CLIP-seq
MIRT958763	hsa-miR-762	CLIP-seq
MIRT958718	hsa-miR-3127-3p	CLIP-seq
MIRT958726	hsa-miR-4269	CLIP-seq
MIRT958727	hsa-miR-4313	CLIP-seq
MIRT958729	hsa-miR-4438	CLIP-seq
MIRT958750	hsa-miR-5095	CLIP-seq
MIRT1984011	hsa-miR-1293	CLIP-seq
MIRT958717	hsa-miR-1324	CLIP-seq
MIRT958753	hsa-miR-1909	CLIP-seq
MIRT1984012	hsa-miR-1915	CLIP-seq
MIRT958754	hsa-miR-214	CLIP-seq
MIRT958718	hsa-miR-3127-3p	CLIP-seq
MIRT958719	hsa-miR-3131	CLIP-seq
MIRT958720	hsa-miR-3157-5p	CLIP-seq
MIRT1984013	hsa-miR-329	CLIP-seq
MIRT958721	hsa-miR-361-3p	CLIP-seq
MIRT958755	hsa-miR-3619-5p	CLIP-seq
MIRT1984014	hsa-miR-362-3p	CLIP-seq
MIRT1984015	hsa-miR-3657	CLIP-seq
MIRT1984016	hsa-miR-3675-3p	CLIP-seq
MIRT1984017	hsa-miR-3675-5p	CLIP-seq
MIRT1984018	hsa-miR-3679-3p	CLIP-seq
MIRT958722	hsa-miR-3690	CLIP-seq
MIRT1984019	hsa-miR-369-3p	CLIP-seq
MIRT1984020	hsa-miR-374a	CLIP-seq
MIRT1984021	hsa-miR-374b	CLIP-seq
MIRT1984022	hsa-miR-3937	CLIP-seq
MIRT958723	hsa-miR-3942-3p	CLIP-seq
MIRT958724	hsa-miR-3945	CLIP-seq
MIRT958725	hsa-miR-4254	CLIP-seq
MIRT958726	hsa-miR-4269	CLIP-seq
MIRT1984023	hsa-miR-4283	CLIP-seq
MIRT958727	hsa-miR-4313	CLIP-seq
MIRT958728	hsa-miR-4323	CLIP-seq
MIRT958729	hsa-miR-4438	CLIP-seq
MIRT1984024	hsa-miR-4483	CLIP-seq
MIRT1984025	hsa-miR-4489	CLIP-seq
MIRT958756	hsa-miR-4492	CLIP-seq
MIRT958757	hsa-miR-4498	CLIP-seq
MIRT958758	hsa-miR-4505	CLIP-seq
MIRT1984026	hsa-miR-4529-5p	CLIP-seq
MIRT958732	hsa-miR-4530	CLIP-seq
MIRT958733	hsa-miR-4632	CLIP-seq
MIRT958734	hsa-miR-4645-5p	CLIP-seq
MIRT958759	hsa-miR-4651	CLIP-seq
MIRT1984027	hsa-miR-4669	CLIP-seq
MIRT958735	hsa-miR-4673	CLIP-seq
MIRT958736	hsa-miR-4691-3p	CLIP-seq
MIRT958738	hsa-miR-4693-3p	CLIP-seq
MIRT958739	hsa-miR-4715-3p	CLIP-seq
MIRT958740	hsa-miR-4722-3p	CLIP-seq
MIRT958741	hsa-miR-4731-5p	CLIP-seq
MIRT958742	hsa-miR-4740-3p	CLIP-seq
MIRT958760	hsa-miR-4742-5p	CLIP-seq
MIRT958744	hsa-miR-4765	CLIP-seq
MIRT958745	hsa-miR-4793-5p	CLIP-seq
MIRT958746	hsa-miR-486-3p	CLIP-seq
MIRT1984028	hsa-miR-498	CLIP-seq
MIRT958747	hsa-miR-499-3p	CLIP-seq
MIRT958748	hsa-miR-499a-3p	CLIP-seq
MIRT958749	hsa-miR-503	CLIP-seq
MIRT958750	hsa-miR-5095	CLIP-seq
MIRT1984029	hsa-miR-513a-3p	CLIP-seq
MIRT958761	hsa-miR-608	CLIP-seq
MIRT958751	hsa-miR-611	CLIP-seq
MIRT958752	hsa-miR-642b	CLIP-seq
MIRT958762	hsa-miR-761	CLIP-seq
MIRT958763	hsa-miR-762	CLIP-seq
MIRT958717	hsa-miR-1324	CLIP-seq
MIRT958718	hsa-miR-3127-3p	CLIP-seq
MIRT958719	hsa-miR-3131	CLIP-seq
MIRT958720	hsa-miR-3157-5p	CLIP-seq
MIRT958721	hsa-miR-361-3p	CLIP-seq
MIRT1984018	hsa-miR-3679-3p	CLIP-seq
MIRT1984022	hsa-miR-3937	CLIP-seq
MIRT958724	hsa-miR-3945	CLIP-seq
MIRT958726	hsa-miR-4269	CLIP-seq
MIRT958727	hsa-miR-4313	CLIP-seq
MIRT958728	hsa-miR-4323	CLIP-seq
MIRT958729	hsa-miR-4438	CLIP-seq
MIRT958756	hsa-miR-4492	CLIP-seq
MIRT958757	hsa-miR-4498	CLIP-seq
MIRT958758	hsa-miR-4505	CLIP-seq
MIRT958731	hsa-miR-4514	CLIP-seq
MIRT1984026	hsa-miR-4529-5p	CLIP-seq
MIRT958732	hsa-miR-4530	CLIP-seq
MIRT958733	hsa-miR-4632	CLIP-seq
MIRT958734	hsa-miR-4645-5p	CLIP-seq
MIRT958735	hsa-miR-4673	CLIP-seq
MIRT958736	hsa-miR-4691-3p	CLIP-seq
MIRT958737	hsa-miR-4692	CLIP-seq
MIRT958738	hsa-miR-4693-3p	CLIP-seq
MIRT958739	hsa-miR-4715-3p	CLIP-seq
MIRT958740	hsa-miR-4722-3p	CLIP-seq
MIRT958741	hsa-miR-4731-5p	CLIP-seq
MIRT958742	hsa-miR-4740-3p	CLIP-seq
MIRT958760	hsa-miR-4742-5p	CLIP-seq
MIRT958745	hsa-miR-4793-5p	CLIP-seq
MIRT958746	hsa-miR-486-3p	CLIP-seq
MIRT958747	hsa-miR-499-3p	CLIP-seq
MIRT958748	hsa-miR-499a-3p	CLIP-seq
MIRT958749	hsa-miR-503	CLIP-seq
MIRT958750	hsa-miR-5095	CLIP-seq
MIRT958751	hsa-miR-611	CLIP-seq
MIRT958752	hsa-miR-642b	CLIP-seq
MIRT958763	hsa-miR-762	CLIP-seq
MIRT958726	hsa-miR-4269	CLIP-seq
MIRT958729	hsa-miR-4438	CLIP-seq
MIRT958747	hsa-miR-499-3p	CLIP-seq
MIRT958748	hsa-miR-499a-3p	CLIP-seq
MIRT958750	hsa-miR-5095	CLIP-seq
MIRT958752	hsa-miR-642b	CLIP-seq
MIRT958722	hsa-miR-3690	CLIP-seq
MIRT958725	hsa-miR-4254	CLIP-seq
MIRT958745	hsa-miR-4793-5p	CLIP-seq
MIRT1984011	hsa-miR-1293	CLIP-seq
MIRT958753	hsa-miR-1909	CLIP-seq
MIRT958754	hsa-miR-214	CLIP-seq
MIRT958718	hsa-miR-3127-3p	CLIP-seq
MIRT958755	hsa-miR-3619-5p	CLIP-seq
MIRT1984015	hsa-miR-3657	CLIP-seq
MIRT1984017	hsa-miR-3675-5p	CLIP-seq
MIRT1984018	hsa-miR-3679-3p	CLIP-seq
MIRT1984022	hsa-miR-3937	CLIP-seq
MIRT1984023	hsa-miR-4283	CLIP-seq
MIRT958727	hsa-miR-4313	CLIP-seq
MIRT1984024	hsa-miR-4483	CLIP-seq
MIRT1984025	hsa-miR-4489	CLIP-seq
MIRT958756	hsa-miR-4492	CLIP-seq
MIRT958757	hsa-miR-4498	CLIP-seq
MIRT958758	hsa-miR-4505	CLIP-seq
MIRT1984026	hsa-miR-4529-5p	CLIP-seq
MIRT958733	hsa-miR-4632	CLIP-seq
MIRT958734	hsa-miR-4645-5p	CLIP-seq
MIRT958759	hsa-miR-4651	CLIP-seq
MIRT1984027	hsa-miR-4669	CLIP-seq
MIRT958735	hsa-miR-4673	CLIP-seq
MIRT958739	hsa-miR-4715-3p	CLIP-seq
MIRT958760	hsa-miR-4742-5p	CLIP-seq
MIRT958761	hsa-miR-608	CLIP-seq
MIRT958762	hsa-miR-761	CLIP-seq
MIRT958763	hsa-miR-762	CLIP-seq
MIRT1984011	hsa-miR-1293	CLIP-seq
MIRT958753	hsa-miR-1909	CLIP-seq
MIRT958754	hsa-miR-214	CLIP-seq
MIRT958718	hsa-miR-3127-3p	CLIP-seq
MIRT958719	hsa-miR-3131	CLIP-seq
MIRT958721	hsa-miR-361-3p	CLIP-seq
MIRT958755	hsa-miR-3619-5p	CLIP-seq
MIRT1984015	hsa-miR-3657	CLIP-seq
MIRT1984017	hsa-miR-3675-5p	CLIP-seq
MIRT1984018	hsa-miR-3679-3p	CLIP-seq
MIRT1984022	hsa-miR-3937	CLIP-seq
MIRT958724	hsa-miR-3945	CLIP-seq
MIRT1984023	hsa-miR-4283	CLIP-seq
MIRT958727	hsa-miR-4313	CLIP-seq
MIRT1984024	hsa-miR-4483	CLIP-seq
MIRT1984025	hsa-miR-4489	CLIP-seq
MIRT958756	hsa-miR-4492	CLIP-seq
MIRT958757	hsa-miR-4498	CLIP-seq
MIRT958758	hsa-miR-4505	CLIP-seq
MIRT1984026	hsa-miR-4529-5p	CLIP-seq
MIRT958732	hsa-miR-4530	CLIP-seq
MIRT958733	hsa-miR-4632	CLIP-seq
MIRT958734	hsa-miR-4645-5p	CLIP-seq
MIRT958759	hsa-miR-4651	CLIP-seq
MIRT1984027	hsa-miR-4669	CLIP-seq
MIRT958735	hsa-miR-4673	CLIP-seq
MIRT958739	hsa-miR-4715-3p	CLIP-seq
MIRT958741	hsa-miR-4731-5p	CLIP-seq
MIRT958760	hsa-miR-4742-5p	CLIP-seq
MIRT958746	hsa-miR-486-3p	CLIP-seq
MIRT958749	hsa-miR-503	CLIP-seq
MIRT958761	hsa-miR-608	CLIP-seq
MIRT958751	hsa-miR-611	CLIP-seq
MIRT958762	hsa-miR-761	CLIP-seq
MIRT958763	hsa-miR-762	CLIP-seq

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001662	Process	Behavioral fear response	IEA
GO:0002191	Process	Cap-dependent translational initiation	TAS	25765080
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	25255371
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IDA	24092755
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IDA	29987188
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	TAS	8961935, 9372926
GO:0005515	Function	Protein binding	IPI	10523622, 10970864, 10996799, 12054647, 12086624, 14701818, 15153109, 15361857, 15567442, 15713657, 16513844, 16556936, 16772376, 16932749, 17284590, 17468741, 17984221, 18606994, 18955708, 19203580, 19716330, 20212144, 21191102, 22872150, 23023399, 23041282, 23409027, 23478064, 236
GO:0005524	Function	ATP binding	IDA	25255371
GO:0005634	Component	Nucleus	IDA	17984221
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	18426977
GO:0005737	Component	Cytoplasm	IDA	17984221, 23814182
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	18426977
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IMP	18426977
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	IMP	18426977
GO:0006412	Process	Translation	IPI	24092755
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IDA	29987188
GO:0006413	Process	Translational initiation	IEA
GO:0006413	Process	Translational initiation	NAS	19239892, 25255371
GO:0006413	Process	Translational initiation	TAS	18426977
GO:0006417	Process	Regulation of translation	IEA
GO:0006446	Process	Regulation of translational initiation	IEA
GO:0006446	Process	Regulation of translational initiation	IMP	19648179
GO:0006446	Process	Regulation of translational initiation	NAS	8961935, 9372926
GO:0008135	Function	Translation factor activity, RNA binding	IEA
GO:0008135	Function	Translation factor activity, RNA binding	IMP	18426977
GO:0008135	Function	Translation factor activity, RNA binding	TAS	9857202, 10880459
GO:0008190	Function	Eukaryotic initiation factor 4E binding	IDA	23814182
GO:0008190	Function	Eukaryotic initiation factor 4E binding	TAS	25765080
GO:0010494	Component	Cytoplasmic stress granule	IDA	17984221
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010507	Process	Negative regulation of autophagy	IMP	18426977
GO:0016020	Component	Membrane	HDA	19946888
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	IBA
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	IDA	25255371
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	NAS	19239892
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	TAS	9857202
GO:0030182	Process	Neuron differentiation	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	18426977
GO:0031369	Function	Translation initiation factor binding	TAS	25765080
GO:0031669	Process	Cellular response to nutrient levels	IMP	18426977
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IDA	23409027
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	TAS	25765080
GO:0036493	Process	Positive regulation of translation in response to endoplasmic reticulum stress	IMP	29062139
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	18426977
GO:0060090	Function	Molecular adaptor activity	TAS	25255371
GO:0080135	Process	Regulation of cellular response to stress	TAS	25765080
GO:0097009	Process	Energy homeostasis	IMP	18426977
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	18426977
GO:1904377	Process	Positive regulation of protein localization to cell periphery	IGI	25533483
GO:1905537	Process	Positive regulation of eukaryotic translation initiation factor 4F complex assembly	IMP	18426977
GO:1905537	Process	Positive regulation of eukaryotic translation initiation factor 4F complex assembly	IPI	23041282
GO:1905606	Process	Regulation of presynapse assembly	IGI	25533483

MIM	HGNC	e!Ensembl
600495	3296	ENSG00000114867

Q04637

Protein name

Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220)

Protein function

Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome (PubMed:29987188). Exists in two complexes, either w

PDB

1LJ2 , 1UG3 , 2W97 , 4AZA , 4F02 , 5EHC , 5EI3 , 5EIR , 5T46 , 5ZK5 , 6ZMW , 8HUJ , 8J7R , 8OZ0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02854	MIF4G	761 → 989	MIF4G domain	Family
PF02847	MA3	1242 → 1354	MA3 domain	Family
PF02020	W2	1520 → 1599	eIF4-gamma/eIF5/eIF2-epsilon	Family

Sequence

MNKAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQHFYPSRAQPPS
SAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTYVVPTQQY
PVQPGAPGFYPGASPTEFGTYAGAYYPAQGVQQFPTGVAPTPVLMNQPPQIAPKRERKTI
RIRDPNQGGKDITEEIMSGARTASTPTPPQTGGGLEPQANGETPQVAVIVRPDDRSQGAI
IADRPGLPGPEHSPSESQPSSPSPTPSPSPVLEPGSEPNLAVLSIPGDTMTTIQMSVEES
TPISRETGEPYRLSPEPTPLAEPILEVEVTLSKPVPESEFSSSPLQAPTPLASHTVEIHE
PNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSE
PEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGG
EELLPPESTPIPANLSQNLEAAAATQVAVSVPKRRRKIKELNKKEAVGDLLDAFKEANPA
VPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQ
WKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLRPLDPTRLQGI
NCGPDFTPSFANLGRTTLSTRGPPRGGPGGELPRGPAGLGPRRSQQGPRKEPRKIIATVL
MTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLM
KQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFR
KLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIK
FIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFN
QMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQGPKTIDQIHKEAEMEEHREHIKV
QQLMAKGSDKRRGGPPGPPISRGLPLVDDGGWNTVPISKGSRPIDTSRLTKITKPGSIDS
NNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTLNRFSALQQAVPTESTDNRRV
VQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEERSRERPSQ
PEGLRKAASLTEDRDRGRDAVKREAALPPVSPLKAALSEEELEKKSKAIIEEYLHLNDMK
EAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGLY
EILELAEDMEIDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAASLLLEIL
GLLCKSMGPKKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPS
EELNRQLEKLLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFETPLRVD
VAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAF
YSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN

Sequence length

1599

Interactions

View interactions

	KEGG		Reactome
	Viral myocarditis		ISG15 antiviral mechanism L13a-mediated translational silencing of Ceruloplasmin expression mTORC1-mediated signalling Deadenylation of mRNA AUF1 (hnRNP D0) binds and destabilizes mRNA Translation initiation complex formation Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S Ribosomal scanning and start codon recognition GTP hydrolysis and joining of the 60S ribosomal subunit Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT LATE ONSET PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EIF4G1-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY LATE-ONSET PARKINSON DISEASE	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson disease 18, autosomal dominant, susceptibility to	Uncertain significance; Likely benign; Benign; risk factor	ClinVar CTD, ClinVar, GenCC CTD, ClinVar, GenCC	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PARKINSON DISEASE, LATE-ONSET	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (113)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acoustic Neuroma	Acoustic Neuroma	BEFREE	26951381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	22767218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29880060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Akinesia	Akinesia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31043796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	31268247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	31268247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	BEFREE	24704100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15193258, 19755858, 22484424, 25593313, 26936396, 27771839, 28599480, 31106142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15193258, 18426977, 23112151, 25593313, 27026610, 27771839, 33693953, 36551184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35787690	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27003362, 27501049, 36897548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33783376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27003362, 27501049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37432996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36897548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29880060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25999352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	23124435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30221473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	23124435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	23124435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	26740508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28253288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28242763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31817792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31817792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15761962, 35346324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22767218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	16049284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	15455398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	15455398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31496918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary late-onset Parkinson disease	Hereditary Parkinson`s Disease	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperproinsulinemia	Hyperproinsulinemia	BEFREE	31300553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27771839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic basal ganglia calcification 1	Basal Ganglia Calcification	BEFREE	22772876		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30084529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	31268247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	19525934, 19755858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29781401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	25241901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	21907011, 23124435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	21907011, 23124435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28715695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27003362, 27501049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11120763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24844222	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25839159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	25839159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	25839159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30066885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31496918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19755858, 22484424, 25593313, 26936396, 27771839, 28599480, 31106142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31817792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27003362, 27501049, 28903455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29748619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18719377, 22356766, 23095751, 23102376, 25263391, 25593033, 25593313, 25717031, 27789529, 28757063, 29169064, 29581834, 31416906, 31496918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	26951381, 31848295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29880060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	29880060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25079330, 26717892, 27879264, 30374200		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30084529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	23124435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28610844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28610844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	24260583, 24711125, 29116477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	32659970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	25404689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24815186, 25197055, 25717031, 26976208, 27501049		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	25717031	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20398343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11857405, 15715967, 18593934, 18708753, 18719377, 19525934, 20398343, 22356766, 22484424, 22767218, 23095751, 25263391, 26317515, 26951381, 27003362, 29748619, 31817792 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	38327202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32593299, 33540613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26965686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	26740508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27501049, 28903455, 30420719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31043796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21425343, 21907011, 22561553, 22658323, 22707335, 22772876, 23092605, 23261770, 23408866, 23462481, 23562511, 23726718, 24080171, 24373818, 24704100 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21907011, 22561553, 22658323, 23124435, 23408866, 23617574, 26490695, 29718834, 30833663, 33818904, 34148545, 34382491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 18	Parkinson disease	GENOMICS_ENGLAND_DG	21907011, 25368108, 26740508		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 18	Parkinson disease	UNIPROT_DG	21907011		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 18	Parkinson disease	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 18	Parkinson disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	22561553, 23124435, 28131822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	23261770		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	BEFREE	21907011, 22561553, 23124435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	21907011, 24704100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31723131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	23124435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29748619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	16412378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	26740508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16412378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11857405, 17290396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17290396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31427592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	11857405, 17290396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31106142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	15455398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24844222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	LHGDN	12239292		★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF4G1 (eukaryotic translation initiation factor 4 gamma 1)