Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	197257
Gene name	Lactate dehydrogenase D
Gene symbol	LDHD
Synonyms (NCBI Gene)	DLACDDLD
Chromosome	16
Chromosome location	16q23.1
Summary	The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript va

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs764877688	G>A,C	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs1567502487	C>A	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant

248

Show/Hide all (248)

miRTarBase ID	miRNA	Experiments	Reference
MIRT704220	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT704219	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT704218	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT704217	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT704216	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT704215	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT704214	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT704213	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT704212	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT704211	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT704210	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT704209	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT704208	hsa-miR-302e	HITS-CLIP	23313552
MIRT704207	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT704206	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT704205	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT704204	hsa-miR-520b	HITS-CLIP	23313552
MIRT704203	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT704202	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT704201	hsa-miR-520e	HITS-CLIP	23313552
MIRT704200	hsa-miR-4700-3p	HITS-CLIP	23313552
MIRT704199	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT704198	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT704197	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT704196	hsa-miR-520h	HITS-CLIP	23313552
MIRT704195	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT704194	hsa-miR-4707-5p	HITS-CLIP	23313552
MIRT704193	hsa-miR-7108-3p	HITS-CLIP	23313552
MIRT704192	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT704191	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT704190	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT704189	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT704188	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT704187	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT704186	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT704185	hsa-miR-5095	HITS-CLIP	23313552
MIRT704184	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT704183	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT524147	hsa-miR-548u	PAR-CLIP	20371350
MIRT524146	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT524145	hsa-miR-8087	PAR-CLIP	20371350
MIRT524144	hsa-miR-6512-5p	PAR-CLIP	20371350
MIRT524143	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT524142	hsa-miR-4436a	PAR-CLIP	20371350
MIRT524141	hsa-miR-5000-3p	PAR-CLIP	20371350
MIRT524140	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT524147	hsa-miR-548u	PAR-CLIP	20371350
MIRT524146	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT524145	hsa-miR-8087	PAR-CLIP	20371350
MIRT524144	hsa-miR-6512-5p	PAR-CLIP	20371350
MIRT524143	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT524142	hsa-miR-4436a	PAR-CLIP	20371350
MIRT524141	hsa-miR-5000-3p	PAR-CLIP	20371350
MIRT524140	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT561201	hsa-miR-4302	PAR-CLIP	20371350
MIRT561200	hsa-miR-4289	PAR-CLIP	20371350
MIRT561199	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT561198	hsa-miR-6077	PAR-CLIP	20371350
MIRT561197	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT561196	hsa-miR-3688-5p	PAR-CLIP	20371350
MIRT561195	hsa-miR-891a-3p	PAR-CLIP	20371350
MIRT561194	hsa-miR-644a	PAR-CLIP	20371350
MIRT561193	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT561192	hsa-miR-4752	PAR-CLIP	20371350
MIRT561191	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT532783	hsa-miR-3133	PAR-CLIP	22012620
MIRT532782	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT532781	hsa-miR-425-5p	PAR-CLIP	22012620
MIRT532780	hsa-miR-1261	PAR-CLIP	22012620
MIRT532779	hsa-miR-548a-3p	PAR-CLIP	22012620
MIRT532778	hsa-miR-548ar-3p	PAR-CLIP	22012620
MIRT532777	hsa-miR-548az-3p	PAR-CLIP	22012620
MIRT532776	hsa-miR-548e-3p	PAR-CLIP	22012620
MIRT532775	hsa-miR-548f-3p	PAR-CLIP	22012620
MIRT532774	hsa-miR-4694-3p	PAR-CLIP	22012620
MIRT532773	hsa-miR-224-3p	PAR-CLIP	22012620
MIRT532772	hsa-miR-522-3p	PAR-CLIP	22012620
MIRT532771	hsa-miR-541-5p	PAR-CLIP	22012620
MIRT532770	hsa-miR-4731-3p	PAR-CLIP	22012620
MIRT532769	hsa-miR-4801	PAR-CLIP	22012620
MIRT532768	hsa-miR-892b	PAR-CLIP	22012620
MIRT532767	hsa-miR-5584-5p	PAR-CLIP	22012620
MIRT532766	hsa-miR-6750-5p	PAR-CLIP	22012620
MIRT532765	hsa-miR-6822-5p	PAR-CLIP	22012620
MIRT532764	hsa-miR-9500	PAR-CLIP	22012620
MIRT532763	hsa-miR-3938	PAR-CLIP	22012620
MIRT532762	hsa-miR-454-5p	PAR-CLIP	22012620
MIRT532761	hsa-miR-4794	PAR-CLIP	22012620
MIRT532760	hsa-miR-664a-5p	PAR-CLIP	22012620
MIRT532759	hsa-miR-6069	PAR-CLIP	22012620
MIRT532758	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT532757	hsa-miR-3153	PAR-CLIP	22012620
MIRT532756	hsa-miR-6733-5p	PAR-CLIP	22012620
MIRT532755	hsa-miR-6739-5p	PAR-CLIP	22012620
MIRT532754	hsa-miR-4694-5p	PAR-CLIP	22012620
MIRT532753	hsa-miR-4425	PAR-CLIP	22012620
MIRT532752	hsa-miR-3147	PAR-CLIP	22012620
MIRT532751	hsa-miR-6883-3p	PAR-CLIP	22012620
MIRT532750	hsa-miR-450a-1-3p	PAR-CLIP	22012620
MIRT524147	hsa-miR-548u	PAR-CLIP	23446348
MIRT524146	hsa-miR-7161-5p	PAR-CLIP	23446348
MIRT524145	hsa-miR-8087	PAR-CLIP	23446348
MIRT524144	hsa-miR-6512-5p	PAR-CLIP	23446348
MIRT524143	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT524142	hsa-miR-4436a	PAR-CLIP	23446348
MIRT524141	hsa-miR-5000-3p	PAR-CLIP	23446348
MIRT524140	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT704220	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT704219	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT704218	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT704217	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT704216	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT704215	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT704214	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT704213	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT704212	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT704211	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT704210	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT704209	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT704208	hsa-miR-302e	HITS-CLIP	23313552
MIRT704207	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT704206	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT704205	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT704204	hsa-miR-520b	HITS-CLIP	23313552
MIRT704203	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT704202	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT704201	hsa-miR-520e	HITS-CLIP	23313552
MIRT704200	hsa-miR-4700-3p	HITS-CLIP	23313552
MIRT704199	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT704198	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT704197	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT704196	hsa-miR-520h	HITS-CLIP	23313552
MIRT704195	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT704194	hsa-miR-4707-5p	HITS-CLIP	23313552
MIRT704193	hsa-miR-7108-3p	HITS-CLIP	23313552
MIRT704192	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT704191	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT704190	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT704189	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT704188	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT704187	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT704186	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT704185	hsa-miR-5095	HITS-CLIP	23313552
MIRT704184	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT704183	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT524147	hsa-miR-548u	PAR-CLIP	20371350
MIRT524146	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT524145	hsa-miR-8087	PAR-CLIP	20371350
MIRT524144	hsa-miR-6512-5p	PAR-CLIP	20371350
MIRT524143	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT524142	hsa-miR-4436a	PAR-CLIP	20371350
MIRT524141	hsa-miR-5000-3p	PAR-CLIP	20371350
MIRT524140	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT524147	hsa-miR-548u	PAR-CLIP	20371350
MIRT524146	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT524145	hsa-miR-8087	PAR-CLIP	20371350
MIRT524144	hsa-miR-6512-5p	PAR-CLIP	20371350
MIRT524143	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT524142	hsa-miR-4436a	PAR-CLIP	20371350
MIRT524141	hsa-miR-5000-3p	PAR-CLIP	20371350
MIRT524140	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT561201	hsa-miR-4302	PAR-CLIP	20371350
MIRT561200	hsa-miR-4289	PAR-CLIP	20371350
MIRT561199	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT561198	hsa-miR-6077	PAR-CLIP	20371350
MIRT561197	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT561196	hsa-miR-3688-5p	PAR-CLIP	20371350
MIRT561195	hsa-miR-891a-3p	PAR-CLIP	20371350
MIRT561194	hsa-miR-644a	PAR-CLIP	20371350
MIRT561193	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT561192	hsa-miR-4752	PAR-CLIP	20371350
MIRT561191	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT532783	hsa-miR-3133	PAR-CLIP	22012620
MIRT532782	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT532781	hsa-miR-425-5p	PAR-CLIP	22012620
MIRT532780	hsa-miR-1261	PAR-CLIP	22012620
MIRT532779	hsa-miR-548a-3p	PAR-CLIP	22012620
MIRT532778	hsa-miR-548ar-3p	PAR-CLIP	22012620
MIRT532777	hsa-miR-548az-3p	PAR-CLIP	22012620
MIRT532776	hsa-miR-548e-3p	PAR-CLIP	22012620
MIRT532775	hsa-miR-548f-3p	PAR-CLIP	22012620
MIRT532774	hsa-miR-4694-3p	PAR-CLIP	22012620
MIRT532773	hsa-miR-224-3p	PAR-CLIP	22012620
MIRT532772	hsa-miR-522-3p	PAR-CLIP	22012620
MIRT532771	hsa-miR-541-5p	PAR-CLIP	22012620
MIRT532770	hsa-miR-4731-3p	PAR-CLIP	22012620
MIRT532769	hsa-miR-4801	PAR-CLIP	22012620
MIRT532768	hsa-miR-892b	PAR-CLIP	22012620
MIRT532767	hsa-miR-5584-5p	PAR-CLIP	22012620
MIRT532766	hsa-miR-6750-5p	PAR-CLIP	22012620
MIRT532765	hsa-miR-6822-5p	PAR-CLIP	22012620
MIRT532764	hsa-miR-9500	PAR-CLIP	22012620
MIRT532763	hsa-miR-3938	PAR-CLIP	22012620
MIRT532762	hsa-miR-454-5p	PAR-CLIP	22012620
MIRT532761	hsa-miR-4794	PAR-CLIP	22012620
MIRT532760	hsa-miR-664a-5p	PAR-CLIP	22012620
MIRT532759	hsa-miR-6069	PAR-CLIP	22012620
MIRT532758	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT532757	hsa-miR-3153	PAR-CLIP	22012620
MIRT532756	hsa-miR-6733-5p	PAR-CLIP	22012620
MIRT532755	hsa-miR-6739-5p	PAR-CLIP	22012620
MIRT532754	hsa-miR-4694-5p	PAR-CLIP	22012620
MIRT532753	hsa-miR-4425	PAR-CLIP	22012620
MIRT532752	hsa-miR-3147	PAR-CLIP	22012620
MIRT532751	hsa-miR-6883-3p	PAR-CLIP	22012620
MIRT532750	hsa-miR-450a-1-3p	PAR-CLIP	22012620
MIRT524147	hsa-miR-548u	PAR-CLIP	23446348
MIRT524146	hsa-miR-7161-5p	PAR-CLIP	23446348
MIRT524145	hsa-miR-8087	PAR-CLIP	23446348
MIRT524144	hsa-miR-6512-5p	PAR-CLIP	23446348
MIRT524143	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT524142	hsa-miR-4436a	PAR-CLIP	23446348
MIRT524141	hsa-miR-5000-3p	PAR-CLIP	23446348
MIRT524140	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT1106406	hsa-miR-1253	CLIP-seq
MIRT1106407	hsa-miR-1275	CLIP-seq
MIRT1106408	hsa-miR-4428	CLIP-seq
MIRT1106409	hsa-miR-4434	CLIP-seq
MIRT1106410	hsa-miR-4516	CLIP-seq
MIRT1106411	hsa-miR-4525	CLIP-seq
MIRT1106412	hsa-miR-4665-5p	CLIP-seq
MIRT1106413	hsa-miR-4723-5p	CLIP-seq
MIRT1106414	hsa-miR-556-3p	CLIP-seq
MIRT1106415	hsa-miR-625	CLIP-seq
MIRT1106416	hsa-miR-1226	CLIP-seq
MIRT1106417	hsa-miR-125a-3p	CLIP-seq
MIRT1106418	hsa-miR-3179	CLIP-seq
MIRT1106419	hsa-miR-3670	CLIP-seq
MIRT1106420	hsa-miR-4300	CLIP-seq
MIRT1106421	hsa-miR-4326	CLIP-seq
MIRT1106422	hsa-miR-4421	CLIP-seq
MIRT1106423	hsa-miR-4716-3p	CLIP-seq
MIRT1106424	hsa-miR-4733-3p	CLIP-seq
MIRT1106425	hsa-miR-587	CLIP-seq
MIRT1106415	hsa-miR-625	CLIP-seq
MIRT1106426	hsa-miR-920	CLIP-seq
MIRT1106419	hsa-miR-3670	CLIP-seq
MIRT1106420	hsa-miR-4300	CLIP-seq
MIRT1106425	hsa-miR-587	CLIP-seq
MIRT1106426	hsa-miR-920	CLIP-seq
MIRT1106419	hsa-miR-3670	CLIP-seq
MIRT1106420	hsa-miR-4300	CLIP-seq
MIRT1106425	hsa-miR-587	CLIP-seq
MIRT1106426	hsa-miR-920	CLIP-seq
MIRT1106419	hsa-miR-3670	CLIP-seq
MIRT1106420	hsa-miR-4300	CLIP-seq
MIRT1106425	hsa-miR-587	CLIP-seq
MIRT1106426	hsa-miR-920	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004457	Function	Lactate dehydrogenase activity	IDA	38373542
GO:0004458	Function	D-lactate dehydrogenase (cytochrome) activity	IBA
GO:0004458	Function	D-lactate dehydrogenase (cytochrome) activity	IEA
GO:0005515	Function	Protein binding	IPI	12127981
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0008720	Function	D-lactate dehydrogenase (NAD+) activity	IBA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IBA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0071949	Function	FAD binding	IEA
GO:1903457	Process	Lactate catabolic process	IBA
GO:1903457	Process	Lactate catabolic process	IMP	30931947

MIM	HGNC	e!Ensembl
607490	19708	ENSG00000166816

Q86WU2

Protein name

Probable D-lactate dehydrogenase, mitochondrial (DLD) (Lactate dehydrogenase D) (EC 1.1.2.4)

Protein function

Involved in D-lactate, but not L-lactate catabolic process.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01565	FAD_binding_4	66 → 203	FAD binding domain	Domain
PF02913	FAD-oxidase_C	265 → 506	FAD linked oxidases, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed moderately in heart and liver and at lower levels in skeletal muscle and kidney. {ECO:0000269|PubMed:12127981}.

Sequence

MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESV
HRCEPPDAVVWPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMD
RILELNQEDFSVVVEPGVTRKALNAHLRDSGLWFPVDPGADASLCGMAATGASGTNAVRY
GTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYSPCVSLGRRKSAAGYN
LTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIE
FLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEA
EERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVG
HVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV
GAVGVETMRQLKAVLDPQGLMNPGKVL

Sequence length

507

Interactions

View interactions

	KEGG		Reactome
	Pyruvate metabolism Metabolic pathways		Mitochondrial protein import

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal circulating lactate dehydrogenase concentration	Likely pathogenic	rs1567502487, rs764877688	RCV000722078 RCV000722079	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lactic aciduria due to D-lactic acid	Likely pathogenic; Pathogenic	rs1567502487, rs764877688, rs2036459233	RCV000766213 RCV000766212 RCV001093610	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
D-LACTIC ACIDURIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
D-LACTIC ACIDURIA WITH GOUT	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LDHD-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (172)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acidosis Lactic	Lactic acidosis	Pubtator	40390331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenine phosphoribosyltransferase deficiency	Adenine Phosphoribosyltransferase Deficiency	BEFREE	8887680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30980524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	29160911, 8631127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	17553685, 27928113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28109288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23349017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	14770182, 18166348, 24491301, 27196752		★★★★★ ★☆☆☆☆ Found in Text Mining only
ALPHA-KETOGLUTARATE DEHYDROGENASE DEFICIENCY	Oxoglutaricaciduria	BEFREE	15712224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37736681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	9973230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28122051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37547319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28122051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	21846681, 23437133, 24349426, 30898447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15039968, 17016678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	26078703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10570186, 19244345, 26428235, 27866849, 30310926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27110560, 35935587, 36312586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38077227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27303803, 38291366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27303803	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10570186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36826087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36591111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26078703, 29327562, 30616910, 30898447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36158120	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Choriocarcinoma	Choriocarcinoma	BEFREE	12193050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37090740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10023666, 10086335, 10403493, 10783318, 10862053, 10930401, 11255265, 11565796, 11772948, 12193050, 14767555, 1586975, 15883203, 16091008, 16103071 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	15113964, 19141699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12706367, 15284338, 15912043, 19240162, 19508388, 20094072, 20953119, 21732059, 21739483, 21989268, 22446887, 22641662, 23042611, 23098564, 24195777 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38078879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation, type 2C	Congenital disorder of glycosylation	BEFREE	10410995, 10571012, 11326280, 11529501, 9662431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	11326280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital leukocyte adherence deficiency	Congenital Leukocyte Adherence Deficiency	BEFREE	11326279, 12476046, 16455955, 16956371, 19234460, 20216991, 20357244, 21536861, 22564402, 25854317, 9473215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Methemoglobinemia	Congenital Methemoglobinemia	BEFREE	6893937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29992755, 30012866, 30898447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29963157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29563352, 31372277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	26951555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28493867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of butyryl-CoA dehydrogenase	Deficiency Of Butyryl-CoA Dehydrogenase	BEFREE	28218398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28779628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31728039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25723521, 28848155, 30898447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25723521, 28848155, 30898447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37773841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30717346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	31031666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37582812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37582812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10086335, 16204059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	15039968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	569787, 6892725, 6894019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28779628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12193050, 30987996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12193050, 30987996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36270342, 38077227, 40355831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29992755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Injuries	Cardiac injury	Pubtator	36988255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobin M Disease	Hemoglobin M Disease	BEFREE	6893937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	27303803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	40390331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	31589144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30056470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycinemia Nonketotic	Hyperglycemia	Pubtator	29232014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperisoleucinemia	Hyperisoleucinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30898447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24349426, 25723521, 30707220, 30898447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Hypertensive Retinopathy	BEFREE	30707220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	40390331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	15313906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19137636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37275904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	11326280, 17016678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27246008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lactic Acidosis, Congenital Infantile, Due To Lad Deficiency	Lactic Acidosis	BEFREE	24341803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lactic Acidosis, Congenital Infantile, Due To Lad Deficiency	Lactic Acidosis	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language Development Disorders	BEFREE	30999162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	12925875, 23290025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	GENOMICS_ENGLAND_DG	27604308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	35792828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10570186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte Adhesion Deficiency, Type III	Leukocyte adhesion deficiency	BEFREE	20216991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	28779628		★★★★★ ★☆☆☆☆ Found in Text Mining only
LISSENCEPHALY 5	Lissencephaly	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20336154, 28545532, 29212547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27303803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	40390331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20336154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28910321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10570186, 19244345, 27866849, 30310926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30878811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10570186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30179133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26828696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22543857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19321126, 19966286, 26304927, 28545532, 29109061, 31601880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10023666, 10403493, 10783318, 10862053, 10930401, 11772948, 11894120, 14767555, 15883203, 16091008, 16103071, 16293557, 16651716, 16969504, 17436592 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple Syrup Urine Disease	BEFREE	26901124, 29307017, 31830945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple syrup urine disease	Pubtator	31830945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple Syrup Urine Disease	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36431901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31728039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	11326280, 17016678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28545532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23478190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24012808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Methemoglobinemia	Methemoglobinemia	BEFREE	6893937, 9722041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	28993120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30079563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	40389878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	133588, 8990125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	21930696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31764615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34462518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
NADH cytochrome B5 reductase deficiency	Nadh-Cytochrome B5 Reductase Deficiency	CLINGEN_DG	10448086, 12925875, 15712224, 16770810, 23290025, 25251739, 28579060, 8506365, 8968745, 9405644, 9540846, 9934985		★★★★★ ★☆☆☆☆ Found in Text Mining only
NADH cytochrome B5 reductase deficiency	Nadh-Cytochrome B5 Reductase Deficiency	UNIPROT_DG	10448086, 11687750, 12925875, 15712224, 16442803, 16770810, 17404228, 20160912, 8506365, 8968745, 9540846, 9934985		★★★★★ ★☆☆☆☆ Found in Text Mining only
NADH cytochrome B5 reductase deficiency	Nadh-Cytochrome B5 Reductase Deficiency	CLINVAR_DG	11687750, 1347528, 14765544, 15712224, 16442803, 16601893, 16770810, 18362926, 21558426, 21930696, 23290025, 23478190, 23995961, 24516753, 25251739 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
NADH cytochrome B5 reductase deficiency	Nadh-Cytochrome B5 Reductase Deficiency	BEFREE	12925875, 15946682, 16601893, 23290025, 23478190, 24341803, 28579060, 6893937, 8652022, 9540846		★★★★★ ★☆☆☆☆ Found in Text Mining only
NADH cytochrome B5 reductase deficiency	Nadh-Cytochrome B5 Reductase Deficiency	ORPHANET_DG	24777537		★★★★★ ★☆☆☆☆ Found in Text Mining only
NADH cytochrome B5 reductase deficiency	Nadh-Cytochrome B5 Reductase Deficiency	GENOMICS_ENGLAND_DG	27604308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	40083932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	40390331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11772948, 12193050, 12651912, 15313906, 19321126, 19508388, 19787266, 20094072, 20953119, 23418515, 24491301, 25384704, 25789966, 26250123, 27455418 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28058510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	29232014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12193050, 26428235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30179133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26961748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28779628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	28250286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	25741691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37215133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	31475906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	28779628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33678329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28779628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26828696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyruvate Dehydrogenase Complex Deficiency Disease	Pyruvate Dehydrogenase Complex Deficiency Disease	BEFREE	16904023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyruvate dehydrogenase E3 deficiency	Pyruvate Dehydrogenase Complex Deficiency Disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	12193050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12193050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	29620641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29232014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	29232014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11972781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific language impairment	Specific Language Impairment	BEFREE	31017004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36618352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28218398, 28315181, 30131228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22543857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26745502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37505170	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	38077227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	19234463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	6894019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26826017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30019821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29194769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	29212547		★★★★★ ★☆☆☆☆ Found in Text Mining only

LDHD (lactate dehydrogenase D)