FAM227B (family with sequence similarity 227 member B)

Gene

• Entrez ID: 196951
• Gene name: Family with sequence similarity 227 member B
• Gene symbol: FAM227B
• Synonyms (NCBI Gene): C15orf33
• Chromosome: 15
• Chromosome location: 15q21.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018932	hsa-miR-335-5p	Microarray	18185580

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q96M60
• Protein name: Protein FAM227B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14922	FWWh	159 → 304	Protein of unknown function	Family

• Sequence:

  MAGQRTCQRRSSRAGPGKMQEPPKSIEEFLKFQNWDYWPREIHFRDDDKWSCTLKKIKED
  SSFVSIYTHLWENVPRIFEALLIMESKLKEYSLILQNHTSEIFKWKSMISETSSYRKLER
  YGEFLKKYHKKKKIMLSDEMETEKNIEGCSFTGFKANELTQLPRHLDAEQIYLFILKAHN
  FDERVFKIWKTHFLSEASIALLHDSFWWWFLHKFRPDRENQDCLFDRISESYVTLFMSIP
  LSRKDAFFQIYPDCLAQAIYATFHEAFPESSYLFNDEFKEDLGNNIFLWCSGLKPQKGFW
  IHWKLKELSTTTIHGSKKAPAKSVKERIADSQEHISTSIDFNIIKILNNPRAYTLPISKE
  ESRLSRLATKSHYSSTGPEFNRVLFNFGGQSPLILYYLKMHELAGISKAPKKTKIKLTKI
  FQEPLPAPTYRDVIKEAKRQFARNQKDFRILQAKATKKPHEVKQDFEKFLHKLRSEAEIE
  RECVASLSSSSSSSPSSTDNYNFEEEEY

• Sequence length: 508

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL CAVITY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC NODULAR GOITER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	28604730		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASDB_DG	21921092		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	GWASCAT_DG	30367059		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of anterior portion of floor of mouth	Malignant Neoplasm Of Anterior Portion Of Floor Of Mouth	GWASCAT_DG	27749845		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of floor of mouth	Malignant neoplasm of floor of mouth	GWASCAT_DG	27749845		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lateral floor of mouth	Malignant tumor of lateral floor of mouth	GWASCAT_DG	27749845		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	GWASCAT_DG	27749845		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of other sites within the lip and oral cavity	Malignant Neoplasm Of Lip And Oral Cavity	GWASCAT_DG	27749845		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of other specified parts of mouth	Malignant Neoplasm Of Mouth	GWASCAT_DG	27749845		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21921092, 30777021	Associate	★☆☆☆☆ Found in Text Mining only