Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	196410
Gene name	Thiol methyltransferase 1B
Gene symbol	TMT1B
Synonyms (NCBI Gene)	ALDIMETTL7B
Chromosome	12
Chromosome location	12q13.2

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments
MIRT1144932	hsa-miR-1208	CLIP-seq
MIRT1144933	hsa-miR-1238	CLIP-seq
MIRT1144934	hsa-miR-3185	CLIP-seq
MIRT1144935	hsa-miR-361-3p	CLIP-seq
MIRT1144936	hsa-miR-3664-3p	CLIP-seq
MIRT1144937	hsa-miR-4255	CLIP-seq
MIRT1144938	hsa-miR-4267	CLIP-seq
MIRT1144939	hsa-miR-4292	CLIP-seq
MIRT1144940	hsa-miR-4308	CLIP-seq
MIRT1144941	hsa-miR-4313	CLIP-seq
MIRT1144942	hsa-miR-4420	CLIP-seq
MIRT1144943	hsa-miR-4691-5p	CLIP-seq
MIRT1144944	hsa-miR-4732-5p	CLIP-seq
MIRT1144945	hsa-miR-5096	CLIP-seq
MIRT1144946	hsa-miR-873	CLIP-seq
MIRT1144932	hsa-miR-1208	CLIP-seq
MIRT2041200	hsa-miR-2110	CLIP-seq
MIRT2041201	hsa-miR-325	CLIP-seq
MIRT2041202	hsa-miR-3612	CLIP-seq
MIRT2041203	hsa-miR-3616-5p	CLIP-seq
MIRT2041204	hsa-miR-3647-5p	CLIP-seq
MIRT2041205	hsa-miR-3689a-3p	CLIP-seq
MIRT2041206	hsa-miR-3689c	CLIP-seq
MIRT2041207	hsa-miR-3923	CLIP-seq
MIRT2041208	hsa-miR-4271	CLIP-seq
MIRT1144942	hsa-miR-4420	CLIP-seq
MIRT2041209	hsa-miR-4443	CLIP-seq
MIRT2041210	hsa-miR-4470	CLIP-seq
MIRT2041211	hsa-miR-4475	CLIP-seq
MIRT2041212	hsa-miR-4505	CLIP-seq
MIRT2041213	hsa-miR-4533	CLIP-seq
MIRT2041214	hsa-miR-4667-5p	CLIP-seq
MIRT2041215	hsa-miR-4670-3p	CLIP-seq
MIRT2041216	hsa-miR-4700-5p	CLIP-seq
MIRT2041217	hsa-miR-4725-3p	CLIP-seq
MIRT2041218	hsa-miR-4728-5p	CLIP-seq
MIRT2041219	hsa-miR-4731-5p	CLIP-seq
MIRT1144944	hsa-miR-4732-5p	CLIP-seq
MIRT2041220	hsa-miR-4735-5p	CLIP-seq
MIRT2041221	hsa-miR-4747-5p	CLIP-seq
MIRT2041222	hsa-miR-485-5p	CLIP-seq
MIRT1144945	hsa-miR-5096	CLIP-seq
MIRT2041223	hsa-miR-573	CLIP-seq
MIRT2041224	hsa-miR-576-5p	CLIP-seq
MIRT2041225	hsa-miR-650	CLIP-seq
MIRT2270898	hsa-miR-185	CLIP-seq
MIRT2041202	hsa-miR-3612	CLIP-seq
MIRT2041205	hsa-miR-3689a-3p	CLIP-seq
MIRT2041206	hsa-miR-3689c	CLIP-seq
MIRT2270899	hsa-miR-4306	CLIP-seq
MIRT2041210	hsa-miR-4470	CLIP-seq
MIRT2041211	hsa-miR-4475	CLIP-seq
MIRT2270900	hsa-miR-4644	CLIP-seq
MIRT2041218	hsa-miR-4728-5p	CLIP-seq
MIRT2041225	hsa-miR-650	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005811	Component	Lipid droplet	IEA
GO:0005829	Component	Cytosol	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008757	Function	S-adenosylmethionine-dependent methyltransferase activity	IEA
GO:0008757	Function	S-adenosylmethionine-dependent methyltransferase activity	IMP	33649426
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018708	Function	Thiol S-methyltransferase activity	IBA
GO:0018708	Function	Thiol S-methyltransferase activity	IDA	37137720
GO:0018708	Function	Thiol S-methyltransferase activity	IEA
GO:0018708	Function	Thiol S-methyltransferase activity	IMP	33649426
GO:0032259	Process	Methylation	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6UX53

Protein name

Thiol S-methyltransferase TMT1B (EC 2.1.1.9) (Methyltransferase-like protein 7B) (Thiol S-methyltransferase METTL7B)

Protein function

Thiol S-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to alkyl and phenolic thiol-containing acceptor substrates. Together with TMT1B accounts for most of S-thiol methylation activity in the endopla

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08241	Methyltransf_11	75 → 172	Methyltransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the liver. {ECO:0000269|PubMed:37137720}.

Sequence

MDILVPLLQLLVLLLTLPLHLMALLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFS
QIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYE
RFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPY
GSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMG
KAVK

Sequence length

244

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33649426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28219369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28219369, 33649426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	CTD_human_DG	28811376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34337010	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31616504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37151605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37275875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37596597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37275875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28219369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31121562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	35397445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31121562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31121562		★★★★★ ★☆☆☆☆ Found in Text Mining only

TMT1B (thiol methyltransferase 1B)