Gene Gene information from NCBI Gene database.
Entrez ID 196403
Gene name Deltex E3 ubiquitin ligase 3
Gene symbol DTX3
Synonyms (NCBI Gene)
RNF154deltex3
Chromosome 12
Chromosome location 12q13.3
Summary DTX3 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009]
miRNA miRNA information provided by mirtarbase database.
213
miRTarBase ID miRNA Experiments Reference
MIRT044416 hsa-miR-320a CLASH 23622248
MIRT947010 hsa-miR-1207-5p CLIP-seq
MIRT947011 hsa-miR-1234 CLIP-seq
MIRT947012 hsa-miR-146a CLIP-seq
MIRT947013 hsa-miR-146b-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19549727, 22493164, 25416956, 32296183, 32814053
GO:0005654 Component Nucleoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0007219 Process Notch signaling pathway IBA
GO:0007219 Process Notch signaling pathway IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613142 24457 ENSG00000178498
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N9I9
Protein name Probable E3 ubiquitin-protein ligase DTX3 (EC 2.3.2.27) (Protein deltex-3) (Deltex3) (RING finger protein 154) (RING-type E3 ubiquitin transferase DTX3)
Protein function Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Probably acts both as a positive and negative regulator of Notch, depending on the developmental
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13923 zf-C3HC4_2 163 202 Domain
PF18102 DTC 210 344 Deltex C-terminal domain Domain
Sequence
MSFVLSRMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVL
QLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEMHRA
GPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTLEKC
RHSFCEGCITRALQVKKACPMC
GRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVI
QYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT
GRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGI
TDD
Sequence length 347
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Notch signaling pathway  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma CTD_human_DG 25151356
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 25151356, 33616774 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Colorectal neoplasm Pubtator 35098394 Inhibit
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer CTD_human_DG 25151356
★☆☆☆☆
Found in Text Mining only
Mammary Carcinoma, Human Marfan Syndrome CTD_human_DG 25151356
★☆☆☆☆
Found in Text Mining only
Mammary Neoplasms Mammary Neoplasms CTD_human_DG 25151356
★☆☆☆☆
Found in Text Mining only
Mammary Neoplasms, Human Mammary Neoplasms CTD_human_DG 25151356
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma BEFREE 31772627
★☆☆☆☆
Found in Text Mining only
Triple Negative Breast Neoplasms Triple negative breast cancer Pubtator 33300431 Associate
★☆☆☆☆
Found in Text Mining only