Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	196264
Gene name	Myelin protein zero like 3
Gene symbol	MPZL3
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q23.3

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT531432	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT531430	hsa-miR-4729	PAR-CLIP	22012620
MIRT531431	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT531429	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT531428	hsa-miR-5696	PAR-CLIP	22012620
MIRT531427	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT531426	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT531425	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT531432	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT531430	hsa-miR-4729	PAR-CLIP	22012620
MIRT531431	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT531429	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT531428	hsa-miR-5696	PAR-CLIP	22012620
MIRT531427	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT531426	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT531425	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT1157344	hsa-miR-4271	CLIP-seq
MIRT1157345	hsa-miR-4725-3p	CLIP-seq
MIRT1157346	hsa-miR-4760-3p	CLIP-seq
MIRT1157347	hsa-miR-488	CLIP-seq
MIRT1157348	hsa-miR-664	CLIP-seq
MIRT2045073	hsa-miR-1298	CLIP-seq
MIRT2045074	hsa-miR-3120-3p	CLIP-seq
MIRT1157344	hsa-miR-4271	CLIP-seq
MIRT2045075	hsa-miR-4275	CLIP-seq
MIRT2045076	hsa-miR-4693-3p	CLIP-seq
MIRT2045077	hsa-miR-4712-3p	CLIP-seq
MIRT1157345	hsa-miR-4725-3p	CLIP-seq
MIRT1157346	hsa-miR-4760-3p	CLIP-seq
MIRT1157347	hsa-miR-488	CLIP-seq
MIRT2045078	hsa-miR-627	CLIP-seq
MIRT1157348	hsa-miR-664	CLIP-seq
MIRT2045079	hsa-miR-924	CLIP-seq
MIRT1157344	hsa-miR-4271	CLIP-seq
MIRT1157345	hsa-miR-4725-3p	CLIP-seq
MIRT1157346	hsa-miR-4760-3p	CLIP-seq
MIRT1157347	hsa-miR-488	CLIP-seq
MIRT1157348	hsa-miR-664	CLIP-seq
MIRT2572977	hsa-miR-4272	CLIP-seq
MIRT2572977	hsa-miR-4272	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21982860
GO:0005886	Component	Plasma membrane	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0016020	Component	Membrane	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0042633	Process	Hair cycle	IEA

MIM	HGNC	e!Ensembl
611707	27279	ENSG00000160588

Q6UWV2

Protein name

Myelin protein zero-like protein 3

Protein function

Mediates homophilic cell-cell adhesion.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	36 → 148	Immunoglobulin V-set domain	Domain

Sequence

MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDV
TDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTI
KDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVR
MGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY

Sequence length

235

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	31326317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	19054061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30307058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30307058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39290707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	GWASCAT_DG	31326317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	30307058, 31310695		★★★★★ ★☆☆☆☆ Found in Text Mining only

MPZL3 (myelin protein zero like 3)