EGR4 (early growth response 4)

Gene

• Entrez ID: 1961
• Gene name: Early growth response 4
• Gene symbol: EGR4
• Synonyms (NCBI Gene): AT133, NGFI-C, NGFIC, PAT133
• Chromosome: 2
• Chromosome location: 2p13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT955319	hsa-miR-138	CLIP-seq
MIRT955320	hsa-miR-3907	CLIP-seq
MIRT955321	hsa-miR-4471	CLIP-seq
MIRT955322	hsa-miR-4487	CLIP-seq
MIRT955323	hsa-miR-548q	CLIP-seq
MIRT955319	hsa-miR-138	CLIP-seq
MIRT955320	hsa-miR-3907	CLIP-seq
MIRT955321	hsa-miR-4471	CLIP-seq
MIRT955322	hsa-miR-4487	CLIP-seq
MIRT955323	hsa-miR-548q	CLIP-seq
MIRT955319	hsa-miR-138	CLIP-seq
MIRT955320	hsa-miR-3907	CLIP-seq
MIRT955321	hsa-miR-4471	CLIP-seq
MIRT955322	hsa-miR-4487	CLIP-seq
MIRT955323	hsa-miR-548q	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12560487
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	1584812
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1658795
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12560487
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 128992
• HGNC: 3241
• e!Ensembl: ENSG00000135625

Protein

• UniProt ID: Q05215
• Protein name: Early growth response protein 4 (EGR-4) (AT133)
• Protein function: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCGGGGGCG-3' (GSG). Activates the transcription of target genes whose products are required for mitogenesis and differentiation (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	483 → 507	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	513 → 535	Zinc finger, C2H2 type	Domain

• Sequence:

  MAVARGVGSPEPAPPQLYKWGGCGLGEPGSALERRGAAARGRCGRARAPRLPDSFPRGEC
  PKPGARAPRSVRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKS
  TEGCCAEPSAELPRLPARDAPAATGYPGAGDFLSWALNSCGASGDLADSCFLEGPAPTPP
  PGLSYSGSFFIQAVPEHPHDPEALFNLMSGILGLAPFPGPEAAASRSPLDAPFPAGSDAL
  LPGPPDLYSPDLGAAPFPEAFWEASPCAGAPSQCLYEPQLSPPDVKPGLRAPPASPALDA
  VSAFKGPYAPWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPA
  NRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLR
  SAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHA
  KAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKP
  FACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFASL

• Sequence length: 589

Pathways

Reactome:

NGF-stimulated transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	31852273	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar I disorder	Bipolar Disorder	BEFREE	22370066		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31844579		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36046377	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31852273	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	19828938, 26642196		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	28464846	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29580816		★☆☆☆☆ Found in Text Mining only
Leydig cell agenesis	Leydig Cell Agenesis	BEFREE	26642196		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30556283		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30556283		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	10529423		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	19828938		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	15538567		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17360599, 20687139, 22691714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17360599, 22691714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25411851		★☆☆☆☆ Found in Text Mining only