Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	196051
Gene name	Phospholipid phosphatase 4
Gene symbol	PLPP4
Synonyms (NCBI Gene)	DPPL2PPAPDC1PPAPDC1A
Chromosome	10
Chromosome location	10q26.12

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT625517	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT625516	hsa-miR-148a-3p	HITS-CLIP	23824327
MIRT625515	hsa-miR-148b-3p	HITS-CLIP	23824327
MIRT625514	hsa-miR-152-3p	HITS-CLIP	23824327
MIRT625513	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT625512	hsa-miR-1825	HITS-CLIP	23824327
MIRT625511	hsa-miR-199a-5p	HITS-CLIP	23824327
MIRT625510	hsa-miR-199b-5p	HITS-CLIP	23824327
MIRT625509	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT625508	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT625507	hsa-miR-4252	HITS-CLIP	23824327
MIRT625506	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT625517	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT625516	hsa-miR-148a-3p	HITS-CLIP	23824327
MIRT625515	hsa-miR-148b-3p	HITS-CLIP	23824327
MIRT625514	hsa-miR-152-3p	HITS-CLIP	23824327
MIRT625513	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT625512	hsa-miR-1825	HITS-CLIP	23824327
MIRT625511	hsa-miR-199a-5p	HITS-CLIP	23824327
MIRT625510	hsa-miR-199b-5p	HITS-CLIP	23824327
MIRT625509	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT625508	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT625507	hsa-miR-4252	HITS-CLIP	23824327
MIRT625506	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT625517	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT625516	hsa-miR-148a-3p	HITS-CLIP	23824327
MIRT625515	hsa-miR-148b-3p	HITS-CLIP	23824327
MIRT625514	hsa-miR-152-3p	HITS-CLIP	23824327
MIRT625513	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT625512	hsa-miR-1825	HITS-CLIP	23824327
MIRT625511	hsa-miR-199a-5p	HITS-CLIP	23824327
MIRT625510	hsa-miR-199b-5p	HITS-CLIP	23824327
MIRT625509	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT625508	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT625507	hsa-miR-4252	HITS-CLIP	23824327
MIRT625506	hsa-miR-455-3p	HITS-CLIP	23824327

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000810	Function	Diacylglycerol diphosphate phosphatase activity	IDA	17590538
GO:0000810	Function	Diacylglycerol diphosphate phosphatase activity	IEA
GO:0001835	Process	Blastocyst hatching	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IBA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0008195	Function	Phosphatidate phosphatase activity	EXP	17590538
GO:0008195	Function	Phosphatidate phosphatase activity	IBA
GO:0008195	Function	Phosphatidate phosphatase activity	IDA	17590538
GO:0008195	Function	Phosphatidate phosphatase activity	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0046839	Process	Phospholipid dephosphorylation	IBA
GO:0046839	Process	Phospholipid dephosphorylation	IDA	17590538
GO:0090279	Process	Regulation of calcium ion import	IMP	28851360

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5VZY2

Protein name

Phospholipid phosphatase 4 (EC 3.1.3.4) (EC 3.6.1.75) (Phosphatidic acid phosphatase type 2 domain-containing protein 1A)

Protein function

Magnesium-independent phospholipid phosphatase with broad substrate specificity (PubMed:17590538). Preferentially catalyzes the conversion of diacylglycerol pyrophosphate into phosphatidate but can also act on phosphatidate and lysophosphatidate

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01569	PAP2	83 → 229	PAP2 superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus. {ECO:0000269|PubMed:17590538}.

Sequence

MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL
TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG
VMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC
AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS
LRVPASLKKEERPTADSAPSLPLEGITEGPV

Sequence length

271

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Glycerophospholipid metabolism		Role of phospholipids in phagocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28851360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25201346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25201346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28851360	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28851360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28851360	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28851360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25201346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34776419	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	31095341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28851360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30361512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PLPP4 (phospholipid phosphatase 4)