Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	196
Gene name	Aryl hydrocarbon receptor
Gene symbol	AHR
Synonyms (NCBI Gene)	FVH3RP85bHLHe76
Chromosome	7
Chromosome location	7p21.1
Summary	The protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1562481438	G>A	Pathogenic	Splice donor variant
rs1562482694	C>T	Likely-pathogenic	Coding sequence variant, stop gained

717

Show/Hide all (717)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002653	hsa-miR-124-3p	Microarray	15685193
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayWestern blot	22024478
MIRT001753	hsa-miR-375	Other	15806104
MIRT020178	hsa-miR-130b-3p	Sequencing	20371350
MIRT002653	hsa-miR-124-3p	Other	15806104
MIRT002653	hsa-miR-124-3p	Microarray	15685193
MIRT027562	hsa-miR-98-5p	Microarray	19088304
MIRT050123	hsa-miR-26a-5p	CLASH	23622248
MIRT039593	hsa-miR-625-5p	CLASH	23622248
MIRT438216	hsa-miR-181a-5p	qRT-PCRWestern blot	24329418
MIRT438216	hsa-miR-181a-5p	qRT-PCRWestern blot	24329418
MIRT675751	hsa-miR-4761-5p	HITS-CLIP	23824327
MIRT675750	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT675749	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT675748	hsa-miR-4284	HITS-CLIP	23824327
MIRT675747	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT675746	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT675745	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT675744	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT675743	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT675742	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT675741	hsa-miR-1233-5p	HITS-CLIP	23824327
MIRT675740	hsa-miR-6778-5p	HITS-CLIP	23824327
MIRT675739	hsa-miR-7977	HITS-CLIP	23824327
MIRT675738	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT675737	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT675736	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT675735	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT675734	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT675733	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT675732	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT675731	hsa-miR-3689c	HITS-CLIP	23824327
MIRT675730	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT675729	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT675728	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT675727	hsa-miR-3122	HITS-CLIP	23824327
MIRT675726	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT675725	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT675724	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT482202	hsa-miR-383-5p	PAR-CLIP	23592263
MIRT482201	hsa-miR-1197	PAR-CLIP	23592263
MIRT482200	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT482199	hsa-miR-16-1-3p	PAR-CLIP	23592263
MIRT482198	hsa-miR-4699-5p	PAR-CLIP	23592263
MIRT482197	hsa-miR-4645-3p	PAR-CLIP	23592263
MIRT482196	hsa-miR-1258	PAR-CLIP	23592263
MIRT482195	hsa-miR-4775	PAR-CLIP	23592263
MIRT482194	hsa-miR-3117-3p	PAR-CLIP	23592263
MIRT482193	hsa-miR-4774-3p	PAR-CLIP	23592263
MIRT482192	hsa-miR-3152-5p	PAR-CLIP	23592263
MIRT103158	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT103162	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT482191	hsa-miR-4459	PAR-CLIP	23592263
MIRT482190	hsa-miR-665	PAR-CLIP	23592263
MIRT482189	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT482188	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT482187	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT482186	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT482185	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT482184	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT482183	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT482182	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT482181	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT482180	hsa-miR-4458	PAR-CLIP	23592263
MIRT482179	hsa-miR-4500	PAR-CLIP	23592263
MIRT027562	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT482178	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT482176	hsa-miR-6086	PAR-CLIP	23592263
MIRT482177	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT482175	hsa-miR-4451	PAR-CLIP	23592263
MIRT482174	hsa-miR-1227-3p	PAR-CLIP	23592263
MIRT482173	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT482172	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT482171	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT482170	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT482169	hsa-miR-1273e	PAR-CLIP	23592263
MIRT002653	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	26802080
MIRT001753	hsa-miR-375	Western blottingMicroarrayqRT-PCRFlow cytometry	33754048
MIRT675751	hsa-miR-4761-5p	HITS-CLIP	23824327
MIRT675750	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT675749	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT675748	hsa-miR-4284	HITS-CLIP	23824327
MIRT675747	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT675746	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT675745	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT675744	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT675743	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT675742	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT675741	hsa-miR-1233-5p	HITS-CLIP	23824327
MIRT675740	hsa-miR-6778-5p	HITS-CLIP	23824327
MIRT675739	hsa-miR-7977	HITS-CLIP	23824327
MIRT675738	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT675737	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT675736	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT675735	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT675734	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT675733	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT675732	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT675731	hsa-miR-3689c	HITS-CLIP	23824327
MIRT675730	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT675729	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT675728	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT675727	hsa-miR-3122	HITS-CLIP	23824327
MIRT675726	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT675725	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT675724	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT482202	hsa-miR-383-5p	PAR-CLIP	23592263
MIRT482201	hsa-miR-1197	PAR-CLIP	23592263
MIRT482200	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT482199	hsa-miR-16-1-3p	PAR-CLIP	23592263
MIRT482198	hsa-miR-4699-5p	PAR-CLIP	23592263
MIRT482197	hsa-miR-4645-3p	PAR-CLIP	23592263
MIRT482196	hsa-miR-1258	PAR-CLIP	23592263
MIRT482195	hsa-miR-4775	PAR-CLIP	23592263
MIRT482194	hsa-miR-3117-3p	PAR-CLIP	23592263
MIRT482193	hsa-miR-4774-3p	PAR-CLIP	23592263
MIRT482192	hsa-miR-3152-5p	PAR-CLIP	23592263
MIRT103158	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT103162	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT482191	hsa-miR-4459	PAR-CLIP	23592263
MIRT482190	hsa-miR-665	PAR-CLIP	23592263
MIRT482189	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT482188	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT482187	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT482186	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT482185	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT482184	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT482183	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT482182	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT482181	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT482180	hsa-miR-4458	PAR-CLIP	23592263
MIRT482179	hsa-miR-4500	PAR-CLIP	23592263
MIRT027562	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT482178	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT482176	hsa-miR-6086	PAR-CLIP	23592263
MIRT482177	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT482175	hsa-miR-4451	PAR-CLIP	23592263
MIRT482174	hsa-miR-1227-3p	PAR-CLIP	23592263
MIRT482173	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT482172	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT482171	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT482170	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT482169	hsa-miR-1273e	PAR-CLIP	23592263
MIRT773773	hsa-let-7a	CLIP-seq
MIRT773774	hsa-let-7b	CLIP-seq
MIRT773775	hsa-let-7c	CLIP-seq
MIRT773776	hsa-let-7d	CLIP-seq
MIRT773777	hsa-let-7e	CLIP-seq
MIRT773778	hsa-let-7f	CLIP-seq
MIRT773779	hsa-let-7g	CLIP-seq
MIRT773780	hsa-let-7i	CLIP-seq
MIRT773781	hsa-miR-1193	CLIP-seq
MIRT773782	hsa-miR-1206	CLIP-seq
MIRT773783	hsa-miR-1208	CLIP-seq
MIRT773784	hsa-miR-1224-5p	CLIP-seq
MIRT773785	hsa-miR-124	CLIP-seq
MIRT773786	hsa-miR-1252	CLIP-seq
MIRT773787	hsa-miR-1257	CLIP-seq
MIRT773788	hsa-miR-1267	CLIP-seq
MIRT773789	hsa-miR-1270	CLIP-seq
MIRT773790	hsa-miR-1271	CLIP-seq
MIRT773791	hsa-miR-1284	CLIP-seq
MIRT773792	hsa-miR-1285	CLIP-seq
MIRT773793	hsa-miR-1287	CLIP-seq
MIRT773794	hsa-miR-1305	CLIP-seq
MIRT773795	hsa-miR-141	CLIP-seq
MIRT773796	hsa-miR-142-5p	CLIP-seq
MIRT773797	hsa-miR-181a	CLIP-seq
MIRT773798	hsa-miR-181b	CLIP-seq
MIRT773799	hsa-miR-181c	CLIP-seq
MIRT773800	hsa-miR-181d	CLIP-seq
MIRT773801	hsa-miR-182	CLIP-seq
MIRT773802	hsa-miR-1827	CLIP-seq
MIRT773803	hsa-miR-197	CLIP-seq
MIRT773804	hsa-miR-200a	CLIP-seq
MIRT773805	hsa-miR-2392	CLIP-seq
MIRT773806	hsa-miR-23a	CLIP-seq
MIRT773807	hsa-miR-23b	CLIP-seq
MIRT773808	hsa-miR-23c	CLIP-seq
MIRT773809	hsa-miR-2681	CLIP-seq
MIRT773810	hsa-miR-299-5p	CLIP-seq
MIRT773811	hsa-miR-300	CLIP-seq
MIRT773812	hsa-miR-302a	CLIP-seq
MIRT773813	hsa-miR-302b	CLIP-seq
MIRT773814	hsa-miR-302c	CLIP-seq
MIRT773815	hsa-miR-302d	CLIP-seq
MIRT773816	hsa-miR-302e	CLIP-seq
MIRT773817	hsa-miR-3065-5p	CLIP-seq
MIRT773818	hsa-miR-31	CLIP-seq
MIRT773819	hsa-miR-3121-5p	CLIP-seq
MIRT773820	hsa-miR-3123	CLIP-seq
MIRT773821	hsa-miR-3135b	CLIP-seq
MIRT773822	hsa-miR-3161	CLIP-seq
MIRT773823	hsa-miR-3173-3p	CLIP-seq
MIRT773824	hsa-miR-3176	CLIP-seq
MIRT773825	hsa-miR-3182	CLIP-seq
MIRT773826	hsa-miR-3187-5p	CLIP-seq
MIRT773827	hsa-miR-3190	CLIP-seq
MIRT773828	hsa-miR-34b	CLIP-seq
MIRT773829	hsa-miR-3611	CLIP-seq
MIRT773830	hsa-miR-3614-5p	CLIP-seq
MIRT773831	hsa-miR-3622a-3p	CLIP-seq
MIRT773832	hsa-miR-3622b-3p	CLIP-seq
MIRT773833	hsa-miR-3622b-5p	CLIP-seq
MIRT773834	hsa-miR-362-5p	CLIP-seq
MIRT773835	hsa-miR-369-3p	CLIP-seq
MIRT773836	hsa-miR-3714	CLIP-seq
MIRT773837	hsa-miR-372	CLIP-seq
MIRT773838	hsa-miR-373	CLIP-seq
MIRT773839	hsa-miR-374c	CLIP-seq
MIRT773840	hsa-miR-380	CLIP-seq
MIRT773841	hsa-miR-381	CLIP-seq
MIRT773842	hsa-miR-3910	CLIP-seq
MIRT773843	hsa-miR-3915	CLIP-seq
MIRT773844	hsa-miR-3922-3p	CLIP-seq
MIRT773845	hsa-miR-3924	CLIP-seq
MIRT773846	hsa-miR-3926	CLIP-seq
MIRT773847	hsa-miR-3927	CLIP-seq
MIRT773848	hsa-miR-3928	CLIP-seq
MIRT773849	hsa-miR-3929	CLIP-seq
MIRT773850	hsa-miR-3945	CLIP-seq
MIRT773851	hsa-miR-409-3p	CLIP-seq
MIRT773852	hsa-miR-410	CLIP-seq
MIRT773853	hsa-miR-421	CLIP-seq
MIRT773854	hsa-miR-4253	CLIP-seq
MIRT773855	hsa-miR-4261	CLIP-seq
MIRT773856	hsa-miR-4262	CLIP-seq
MIRT773857	hsa-miR-4272	CLIP-seq
MIRT773858	hsa-miR-4323	CLIP-seq
MIRT773859	hsa-miR-4419b	CLIP-seq
MIRT773860	hsa-miR-4433	CLIP-seq
MIRT773861	hsa-miR-4478	CLIP-seq
MIRT773862	hsa-miR-448	CLIP-seq
MIRT773863	hsa-miR-4491	CLIP-seq
MIRT773864	hsa-miR-4495	CLIP-seq
MIRT773865	hsa-miR-4528	CLIP-seq
MIRT773866	hsa-miR-4649-3p	CLIP-seq
MIRT773867	hsa-miR-4657	CLIP-seq
MIRT773868	hsa-miR-4659a-3p	CLIP-seq
MIRT773869	hsa-miR-4659b-3p	CLIP-seq
MIRT773870	hsa-miR-4666-3p	CLIP-seq
MIRT773871	hsa-miR-4683	CLIP-seq
MIRT773872	hsa-miR-4689	CLIP-seq
MIRT773873	hsa-miR-4704-5p	CLIP-seq
MIRT773874	hsa-miR-4711-5p	CLIP-seq
MIRT773875	hsa-miR-4712-5p	CLIP-seq
MIRT773876	hsa-miR-4716-5p	CLIP-seq
MIRT773877	hsa-miR-4729	CLIP-seq
MIRT773878	hsa-miR-4766-5p	CLIP-seq
MIRT773879	hsa-miR-4768-3p	CLIP-seq
MIRT773880	hsa-miR-4777-3p	CLIP-seq
MIRT773881	hsa-miR-4781-3p	CLIP-seq
MIRT773882	hsa-miR-4786-5p	CLIP-seq
MIRT773883	hsa-miR-4803	CLIP-seq
MIRT773884	hsa-miR-485-5p	CLIP-seq
MIRT773885	hsa-miR-488	CLIP-seq
MIRT773886	hsa-miR-490-5p	CLIP-seq
MIRT773887	hsa-miR-495	CLIP-seq
MIRT773888	hsa-miR-500b	CLIP-seq
MIRT773889	hsa-miR-501-3p	CLIP-seq
MIRT773890	hsa-miR-501-5p	CLIP-seq
MIRT773891	hsa-miR-502-3p	CLIP-seq
MIRT773892	hsa-miR-506	CLIP-seq
MIRT773893	hsa-miR-5096	CLIP-seq
MIRT773894	hsa-miR-519a	CLIP-seq
MIRT773895	hsa-miR-519b-3p	CLIP-seq
MIRT773896	hsa-miR-519c-3p	CLIP-seq
MIRT773897	hsa-miR-520a-3p	CLIP-seq
MIRT773898	hsa-miR-520b	CLIP-seq
MIRT773899	hsa-miR-520c-3p	CLIP-seq
MIRT773900	hsa-miR-520d-3p	CLIP-seq
MIRT773901	hsa-miR-520e	CLIP-seq
MIRT773902	hsa-miR-522	CLIP-seq
MIRT773903	hsa-miR-543	CLIP-seq
MIRT773904	hsa-miR-544b	CLIP-seq
MIRT773905	hsa-miR-548a-5p	CLIP-seq
MIRT773906	hsa-miR-548ab	CLIP-seq
MIRT773907	hsa-miR-548ag	CLIP-seq
MIRT773908	hsa-miR-548ai	CLIP-seq
MIRT773909	hsa-miR-548ak	CLIP-seq
MIRT773910	hsa-miR-548b-5p	CLIP-seq
MIRT773911	hsa-miR-548c-3p	CLIP-seq
MIRT773912	hsa-miR-548c-5p	CLIP-seq
MIRT773913	hsa-miR-548d-5p	CLIP-seq
MIRT773914	hsa-miR-548h	CLIP-seq
MIRT773915	hsa-miR-548i	CLIP-seq
MIRT773916	hsa-miR-548j	CLIP-seq
MIRT773917	hsa-miR-548k	CLIP-seq
MIRT773918	hsa-miR-548l	CLIP-seq
MIRT773919	hsa-miR-548s	CLIP-seq
MIRT773920	hsa-miR-548w	CLIP-seq
MIRT773921	hsa-miR-548y	CLIP-seq
MIRT773922	hsa-miR-559	CLIP-seq
MIRT773923	hsa-miR-570	CLIP-seq
MIRT773924	hsa-miR-576-3p	CLIP-seq
MIRT773925	hsa-miR-612	CLIP-seq
MIRT773926	hsa-miR-620	CLIP-seq
MIRT773927	hsa-miR-622	CLIP-seq
MIRT773928	hsa-miR-653	CLIP-seq
MIRT773929	hsa-miR-655	CLIP-seq
MIRT773930	hsa-miR-659	CLIP-seq
MIRT773931	hsa-miR-7	CLIP-seq
MIRT773932	hsa-miR-767-5p	CLIP-seq
MIRT773933	hsa-miR-769-5p	CLIP-seq
MIRT773934	hsa-miR-770-5p	CLIP-seq
MIRT773935	hsa-miR-802	CLIP-seq
MIRT773936	hsa-miR-875-3p	CLIP-seq
MIRT773937	hsa-miR-96	CLIP-seq
MIRT773938	hsa-miR-98	CLIP-seq
MIRT773773	hsa-let-7a	CLIP-seq
MIRT773774	hsa-let-7b	CLIP-seq
MIRT773775	hsa-let-7c	CLIP-seq
MIRT773776	hsa-let-7d	CLIP-seq
MIRT773777	hsa-let-7e	CLIP-seq
MIRT773778	hsa-let-7f	CLIP-seq
MIRT773779	hsa-let-7g	CLIP-seq
MIRT773780	hsa-let-7i	CLIP-seq
MIRT1545215	hsa-miR-125a-5p	CLIP-seq
MIRT1545216	hsa-miR-125b	CLIP-seq
MIRT773796	hsa-miR-142-5p	CLIP-seq
MIRT1545217	hsa-miR-3149	CLIP-seq
MIRT773847	hsa-miR-3927	CLIP-seq
MIRT1545218	hsa-miR-4319	CLIP-seq
MIRT1545219	hsa-miR-4446-5p	CLIP-seq
MIRT1545220	hsa-miR-4732-3p	CLIP-seq
MIRT1545221	hsa-miR-4755-5p	CLIP-seq
MIRT1545222	hsa-miR-561	CLIP-seq
MIRT1545223	hsa-miR-670	CLIP-seq
MIRT773938	hsa-miR-98	CLIP-seq
MIRT1928404	hsa-miR-340	CLIP-seq
MIRT1928405	hsa-miR-3686	CLIP-seq
MIRT1928406	hsa-miR-4652-3p	CLIP-seq
MIRT773876	hsa-miR-4716-5p	CLIP-seq
MIRT1928407	hsa-miR-4735-5p	CLIP-seq
MIRT1928408	hsa-miR-4742-3p	CLIP-seq
MIRT773893	hsa-miR-5096	CLIP-seq
MIRT773773	hsa-let-7a	CLIP-seq
MIRT773774	hsa-let-7b	CLIP-seq
MIRT773775	hsa-let-7c	CLIP-seq
MIRT773776	hsa-let-7d	CLIP-seq
MIRT773777	hsa-let-7e	CLIP-seq
MIRT773778	hsa-let-7f	CLIP-seq
MIRT773779	hsa-let-7g	CLIP-seq
MIRT773780	hsa-let-7i	CLIP-seq
MIRT773781	hsa-miR-1193	CLIP-seq
MIRT2169126	hsa-miR-1200	CLIP-seq
MIRT2169127	hsa-miR-1202	CLIP-seq
MIRT773783	hsa-miR-1208	CLIP-seq
MIRT2169128	hsa-miR-122	CLIP-seq
MIRT773784	hsa-miR-1224-5p	CLIP-seq
MIRT773788	hsa-miR-1267	CLIP-seq
MIRT2169129	hsa-miR-1279	CLIP-seq
MIRT773791	hsa-miR-1284	CLIP-seq
MIRT2169130	hsa-miR-136	CLIP-seq
MIRT773795	hsa-miR-141	CLIP-seq
MIRT773796	hsa-miR-142-5p	CLIP-seq
MIRT2169131	hsa-miR-148a	CLIP-seq
MIRT2169132	hsa-miR-148b	CLIP-seq
MIRT2169133	hsa-miR-152	CLIP-seq
MIRT773797	hsa-miR-181a	CLIP-seq
MIRT773798	hsa-miR-181b	CLIP-seq
MIRT773799	hsa-miR-181c	CLIP-seq
MIRT773800	hsa-miR-181d	CLIP-seq
MIRT2169134	hsa-miR-192	CLIP-seq
MIRT773803	hsa-miR-197	CLIP-seq
MIRT773804	hsa-miR-200a	CLIP-seq
MIRT2169135	hsa-miR-203	CLIP-seq
MIRT2169136	hsa-miR-2113	CLIP-seq
MIRT2169137	hsa-miR-215	CLIP-seq
MIRT2169138	hsa-miR-219-5p	CLIP-seq
MIRT2169139	hsa-miR-2276	CLIP-seq
MIRT773805	hsa-miR-2392	CLIP-seq
MIRT773806	hsa-miR-23a	CLIP-seq
MIRT773807	hsa-miR-23b	CLIP-seq
MIRT773808	hsa-miR-23c	CLIP-seq
MIRT773809	hsa-miR-2681	CLIP-seq
MIRT773810	hsa-miR-299-5p	CLIP-seq
MIRT773811	hsa-miR-300	CLIP-seq
MIRT773812	hsa-miR-302a	CLIP-seq
MIRT773813	hsa-miR-302b	CLIP-seq
MIRT773814	hsa-miR-302c	CLIP-seq
MIRT773815	hsa-miR-302d	CLIP-seq
MIRT773816	hsa-miR-302e	CLIP-seq
MIRT773820	hsa-miR-3123	CLIP-seq
MIRT773821	hsa-miR-3135b	CLIP-seq
MIRT2169140	hsa-miR-3151	CLIP-seq
MIRT2169141	hsa-miR-3155	CLIP-seq
MIRT2169142	hsa-miR-3155b	CLIP-seq
MIRT2169143	hsa-miR-3159	CLIP-seq
MIRT2169144	hsa-miR-3169	CLIP-seq
MIRT2169145	hsa-miR-3180	CLIP-seq
MIRT2169146	hsa-miR-3180-3p	CLIP-seq
MIRT2169147	hsa-miR-3196	CLIP-seq
MIRT2169148	hsa-miR-3200-3p	CLIP-seq
MIRT2169149	hsa-miR-338-5p	CLIP-seq
MIRT1928404	hsa-miR-340	CLIP-seq
MIRT773828	hsa-miR-34b	CLIP-seq
MIRT773830	hsa-miR-3614-5p	CLIP-seq
MIRT773834	hsa-miR-362-5p	CLIP-seq
MIRT2169150	hsa-miR-3652	CLIP-seq
MIRT2169151	hsa-miR-3671	CLIP-seq
MIRT1928405	hsa-miR-3686	CLIP-seq
MIRT773835	hsa-miR-369-3p	CLIP-seq
MIRT773837	hsa-miR-372	CLIP-seq
MIRT773838	hsa-miR-373	CLIP-seq
MIRT773840	hsa-miR-380	CLIP-seq
MIRT773841	hsa-miR-381	CLIP-seq
MIRT773843	hsa-miR-3915	CLIP-seq
MIRT773847	hsa-miR-3927	CLIP-seq
MIRT773848	hsa-miR-3928	CLIP-seq
MIRT2169152	hsa-miR-3972	CLIP-seq
MIRT2169153	hsa-miR-411	CLIP-seq
MIRT773856	hsa-miR-4262	CLIP-seq
MIRT2169154	hsa-miR-4264	CLIP-seq
MIRT773857	hsa-miR-4272	CLIP-seq
MIRT2169155	hsa-miR-4274	CLIP-seq
MIRT2169156	hsa-miR-4324	CLIP-seq
MIRT2169157	hsa-miR-4328	CLIP-seq
MIRT2169158	hsa-miR-433	CLIP-seq
MIRT2169159	hsa-miR-4430	CLIP-seq
MIRT773860	hsa-miR-4433	CLIP-seq
MIRT2169160	hsa-miR-4438	CLIP-seq
MIRT2169161	hsa-miR-4445	CLIP-seq
MIRT773864	hsa-miR-4495	CLIP-seq
MIRT2169162	hsa-miR-4519	CLIP-seq
MIRT1928406	hsa-miR-4652-3p	CLIP-seq
MIRT773870	hsa-miR-4666-3p	CLIP-seq
MIRT2169163	hsa-miR-4686	CLIP-seq
MIRT773872	hsa-miR-4689	CLIP-seq
MIRT2169164	hsa-miR-4700-3p	CLIP-seq
MIRT773876	hsa-miR-4716-5p	CLIP-seq
MIRT773877	hsa-miR-4729	CLIP-seq
MIRT1928407	hsa-miR-4735-5p	CLIP-seq
MIRT2169165	hsa-miR-4755-3p	CLIP-seq
MIRT2169166	hsa-miR-4759	CLIP-seq
MIRT773879	hsa-miR-4768-3p	CLIP-seq
MIRT2169167	hsa-miR-4772-3p	CLIP-seq
MIRT773881	hsa-miR-4781-3p	CLIP-seq
MIRT2169168	hsa-miR-4782-3p	CLIP-seq
MIRT2169169	hsa-miR-4797-3p	CLIP-seq
MIRT2169170	hsa-miR-483-3p	CLIP-seq
MIRT2169171	hsa-miR-484	CLIP-seq
MIRT773888	hsa-miR-500b	CLIP-seq
MIRT773889	hsa-miR-501-3p	CLIP-seq
MIRT773890	hsa-miR-501-5p	CLIP-seq
MIRT773891	hsa-miR-502-3p	CLIP-seq
MIRT2169172	hsa-miR-505	CLIP-seq
MIRT2169173	hsa-miR-507	CLIP-seq
MIRT2169174	hsa-miR-508-3p	CLIP-seq
MIRT2169175	hsa-miR-5095	CLIP-seq
MIRT773893	hsa-miR-5096	CLIP-seq
MIRT773894	hsa-miR-519a	CLIP-seq
MIRT773895	hsa-miR-519b-3p	CLIP-seq
MIRT773896	hsa-miR-519c-3p	CLIP-seq
MIRT773897	hsa-miR-520a-3p	CLIP-seq
MIRT773898	hsa-miR-520b	CLIP-seq
MIRT773899	hsa-miR-520c-3p	CLIP-seq
MIRT773900	hsa-miR-520d-3p	CLIP-seq
MIRT773901	hsa-miR-520e	CLIP-seq
MIRT773903	hsa-miR-543	CLIP-seq
MIRT773904	hsa-miR-544b	CLIP-seq
MIRT2169176	hsa-miR-548u	CLIP-seq
MIRT2169177	hsa-miR-557	CLIP-seq
MIRT1545222	hsa-miR-561	CLIP-seq
MIRT2169178	hsa-miR-656	CLIP-seq
MIRT2169179	hsa-miR-664	CLIP-seq
MIRT773932	hsa-miR-767-5p	CLIP-seq
MIRT773935	hsa-miR-802	CLIP-seq
MIRT773938	hsa-miR-98	CLIP-seq
MIRT773834	hsa-miR-362-5p	CLIP-seq
MIRT2169157	hsa-miR-4328	CLIP-seq
MIRT773888	hsa-miR-500b	CLIP-seq
MIRT773890	hsa-miR-501-5p	CLIP-seq
MIRT2426116	hsa-miR-3692	CLIP-seq
MIRT2426117	hsa-miR-4436b-5p	CLIP-seq
MIRT2169179	hsa-miR-664	CLIP-seq
MIRT773794	hsa-miR-1305	CLIP-seq
MIRT2435276	hsa-miR-2355-3p	CLIP-seq
MIRT2435277	hsa-miR-3145-3p	CLIP-seq
MIRT2435278	hsa-miR-3647-3p	CLIP-seq
MIRT2435279	hsa-miR-3919	CLIP-seq
MIRT2435280	hsa-miR-4646-3p	CLIP-seq
MIRT2435281	hsa-miR-4672	CLIP-seq
MIRT2435282	hsa-miR-4756-3p	CLIP-seq
MIRT2435283	hsa-miR-513a-3p	CLIP-seq
MIRT773792	hsa-miR-1285	CLIP-seq
MIRT773826	hsa-miR-3187-5p	CLIP-seq
MIRT773827	hsa-miR-3190	CLIP-seq
MIRT773863	hsa-miR-4491	CLIP-seq
MIRT773867	hsa-miR-4657	CLIP-seq
MIRT773887	hsa-miR-495	CLIP-seq
MIRT773911	hsa-miR-548c-3p	CLIP-seq
MIRT773925	hsa-miR-612	CLIP-seq
MIRT773931	hsa-miR-7	CLIP-seq
MIRT773935	hsa-miR-802	CLIP-seq
MIRT773792	hsa-miR-1285	CLIP-seq
MIRT773826	hsa-miR-3187-5p	CLIP-seq
MIRT773911	hsa-miR-548c-3p	CLIP-seq
MIRT773925	hsa-miR-612	CLIP-seq
MIRT773773	hsa-let-7a	CLIP-seq
MIRT773774	hsa-let-7b	CLIP-seq
MIRT773775	hsa-let-7c	CLIP-seq
MIRT773776	hsa-let-7d	CLIP-seq
MIRT773777	hsa-let-7e	CLIP-seq
MIRT773778	hsa-let-7f	CLIP-seq
MIRT773779	hsa-let-7g	CLIP-seq
MIRT773780	hsa-let-7i	CLIP-seq
MIRT773792	hsa-miR-1285	CLIP-seq
MIRT773793	hsa-miR-1287	CLIP-seq
MIRT2471769	hsa-miR-1324	CLIP-seq
MIRT2471770	hsa-miR-145	CLIP-seq
MIRT773802	hsa-miR-1827	CLIP-seq
MIRT2169135	hsa-miR-203	CLIP-seq
MIRT2435276	hsa-miR-2355-3p	CLIP-seq
MIRT773810	hsa-miR-299-5p	CLIP-seq
MIRT773818	hsa-miR-31	CLIP-seq
MIRT2471771	hsa-miR-3121-3p	CLIP-seq
MIRT773820	hsa-miR-3123	CLIP-seq
MIRT773821	hsa-miR-3135b	CLIP-seq
MIRT2435277	hsa-miR-3145-3p	CLIP-seq
MIRT2169141	hsa-miR-3155	CLIP-seq
MIRT2169142	hsa-miR-3155b	CLIP-seq
MIRT2169144	hsa-miR-3169	CLIP-seq
MIRT773824	hsa-miR-3176	CLIP-seq
MIRT773826	hsa-miR-3187-5p	CLIP-seq
MIRT2471772	hsa-miR-323-3p	CLIP-seq
MIRT773828	hsa-miR-34b	CLIP-seq
MIRT773830	hsa-miR-3614-5p	CLIP-seq
MIRT773831	hsa-miR-3622a-3p	CLIP-seq
MIRT773832	hsa-miR-3622b-3p	CLIP-seq
MIRT773833	hsa-miR-3622b-5p	CLIP-seq
MIRT2435278	hsa-miR-3647-3p	CLIP-seq
MIRT2471773	hsa-miR-3663-5p	CLIP-seq
MIRT2471774	hsa-miR-3672	CLIP-seq
MIRT2471775	hsa-miR-3684	CLIP-seq
MIRT1928405	hsa-miR-3686	CLIP-seq
MIRT773835	hsa-miR-369-3p	CLIP-seq
MIRT2471776	hsa-miR-374a	CLIP-seq
MIRT2471777	hsa-miR-374b	CLIP-seq
MIRT773840	hsa-miR-380	CLIP-seq
MIRT2435279	hsa-miR-3919	CLIP-seq
MIRT773844	hsa-miR-3922-3p	CLIP-seq
MIRT773845	hsa-miR-3924	CLIP-seq
MIRT2471778	hsa-miR-3925-3p	CLIP-seq
MIRT773846	hsa-miR-3926	CLIP-seq
MIRT773847	hsa-miR-3927	CLIP-seq
MIRT773849	hsa-miR-3929	CLIP-seq
MIRT2471779	hsa-miR-3942-3p	CLIP-seq
MIRT773850	hsa-miR-3945	CLIP-seq
MIRT773854	hsa-miR-4253	CLIP-seq
MIRT773855	hsa-miR-4261	CLIP-seq
MIRT2471780	hsa-miR-4305	CLIP-seq
MIRT773859	hsa-miR-4419b	CLIP-seq
MIRT2471781	hsa-miR-4432	CLIP-seq
MIRT773860	hsa-miR-4433	CLIP-seq
MIRT2169160	hsa-miR-4438	CLIP-seq
MIRT773861	hsa-miR-4478	CLIP-seq
MIRT773864	hsa-miR-4495	CLIP-seq
MIRT2435280	hsa-miR-4646-3p	CLIP-seq
MIRT773866	hsa-miR-4649-3p	CLIP-seq
MIRT1928406	hsa-miR-4652-3p	CLIP-seq
MIRT2471782	hsa-miR-4671-5p	CLIP-seq
MIRT2435281	hsa-miR-4672	CLIP-seq
MIRT1928407	hsa-miR-4735-5p	CLIP-seq
MIRT1928408	hsa-miR-4742-3p	CLIP-seq
MIRT2435282	hsa-miR-4756-3p	CLIP-seq
MIRT2169166	hsa-miR-4759	CLIP-seq
MIRT773879	hsa-miR-4768-3p	CLIP-seq
MIRT773880	hsa-miR-4777-3p	CLIP-seq
MIRT2471783	hsa-miR-4786-3p	CLIP-seq
MIRT773882	hsa-miR-4786-5p	CLIP-seq
MIRT2471784	hsa-miR-4799-5p	CLIP-seq
MIRT2169171	hsa-miR-484	CLIP-seq
MIRT773884	hsa-miR-485-5p	CLIP-seq
MIRT773887	hsa-miR-495	CLIP-seq
MIRT2471785	hsa-miR-496	CLIP-seq
MIRT2471786	hsa-miR-499-5p	CLIP-seq
MIRT2471787	hsa-miR-500a	CLIP-seq
MIRT2471788	hsa-miR-508-5p	CLIP-seq
MIRT2169175	hsa-miR-5095	CLIP-seq
MIRT773902	hsa-miR-522	CLIP-seq
MIRT773904	hsa-miR-544b	CLIP-seq
MIRT773905	hsa-miR-548a-5p	CLIP-seq
MIRT773906	hsa-miR-548ab	CLIP-seq
MIRT773909	hsa-miR-548ak	CLIP-seq
MIRT773910	hsa-miR-548b-5p	CLIP-seq
MIRT773911	hsa-miR-548c-3p	CLIP-seq
MIRT773912	hsa-miR-548c-5p	CLIP-seq
MIRT773913	hsa-miR-548d-5p	CLIP-seq
MIRT773914	hsa-miR-548h	CLIP-seq
MIRT773915	hsa-miR-548i	CLIP-seq
MIRT773916	hsa-miR-548j	CLIP-seq
MIRT2471789	hsa-miR-548n	CLIP-seq
MIRT773919	hsa-miR-548s	CLIP-seq
MIRT773920	hsa-miR-548w	CLIP-seq
MIRT773921	hsa-miR-548y	CLIP-seq
MIRT773922	hsa-miR-559	CLIP-seq
MIRT2471790	hsa-miR-601	CLIP-seq
MIRT2471791	hsa-miR-605	CLIP-seq
MIRT773925	hsa-miR-612	CLIP-seq
MIRT773927	hsa-miR-622	CLIP-seq
MIRT773933	hsa-miR-769-5p	CLIP-seq
MIRT773936	hsa-miR-875-3p	CLIP-seq
MIRT2471792	hsa-miR-875-5p	CLIP-seq
MIRT773938	hsa-miR-98	CLIP-seq
MIRT773773	hsa-let-7a	CLIP-seq
MIRT773774	hsa-let-7b	CLIP-seq
MIRT773775	hsa-let-7c	CLIP-seq
MIRT773776	hsa-let-7d	CLIP-seq
MIRT773777	hsa-let-7e	CLIP-seq
MIRT773778	hsa-let-7f	CLIP-seq
MIRT773779	hsa-let-7g	CLIP-seq
MIRT773780	hsa-let-7i	CLIP-seq
MIRT773792	hsa-miR-1285	CLIP-seq
MIRT773793	hsa-miR-1287	CLIP-seq
MIRT773802	hsa-miR-1827	CLIP-seq
MIRT2169135	hsa-miR-203	CLIP-seq
MIRT2435276	hsa-miR-2355-3p	CLIP-seq
MIRT773810	hsa-miR-299-5p	CLIP-seq
MIRT773818	hsa-miR-31	CLIP-seq
MIRT2471771	hsa-miR-3121-3p	CLIP-seq
MIRT773820	hsa-miR-3123	CLIP-seq
MIRT773821	hsa-miR-3135b	CLIP-seq
MIRT2435277	hsa-miR-3145-3p	CLIP-seq
MIRT2169141	hsa-miR-3155	CLIP-seq
MIRT2169142	hsa-miR-3155b	CLIP-seq
MIRT2169144	hsa-miR-3169	CLIP-seq
MIRT773824	hsa-miR-3176	CLIP-seq
MIRT773826	hsa-miR-3187-5p	CLIP-seq
MIRT2471772	hsa-miR-323-3p	CLIP-seq
MIRT773828	hsa-miR-34b	CLIP-seq
MIRT773830	hsa-miR-3614-5p	CLIP-seq
MIRT773831	hsa-miR-3622a-3p	CLIP-seq
MIRT773832	hsa-miR-3622b-3p	CLIP-seq
MIRT773833	hsa-miR-3622b-5p	CLIP-seq
MIRT2435278	hsa-miR-3647-3p	CLIP-seq
MIRT2471773	hsa-miR-3663-5p	CLIP-seq
MIRT2471774	hsa-miR-3672	CLIP-seq
MIRT2471775	hsa-miR-3684	CLIP-seq
MIRT1928405	hsa-miR-3686	CLIP-seq
MIRT773835	hsa-miR-369-3p	CLIP-seq
MIRT2471776	hsa-miR-374a	CLIP-seq
MIRT2471777	hsa-miR-374b	CLIP-seq
MIRT773840	hsa-miR-380	CLIP-seq
MIRT2435279	hsa-miR-3919	CLIP-seq
MIRT773844	hsa-miR-3922-3p	CLIP-seq
MIRT773845	hsa-miR-3924	CLIP-seq
MIRT773846	hsa-miR-3926	CLIP-seq
MIRT773847	hsa-miR-3927	CLIP-seq
MIRT773849	hsa-miR-3929	CLIP-seq
MIRT773850	hsa-miR-3945	CLIP-seq
MIRT773854	hsa-miR-4253	CLIP-seq
MIRT773855	hsa-miR-4261	CLIP-seq
MIRT2471780	hsa-miR-4305	CLIP-seq
MIRT773859	hsa-miR-4419b	CLIP-seq
MIRT2471781	hsa-miR-4432	CLIP-seq
MIRT773860	hsa-miR-4433	CLIP-seq
MIRT2169160	hsa-miR-4438	CLIP-seq
MIRT773861	hsa-miR-4478	CLIP-seq
MIRT773864	hsa-miR-4495	CLIP-seq
MIRT2435280	hsa-miR-4646-3p	CLIP-seq
MIRT773866	hsa-miR-4649-3p	CLIP-seq
MIRT1928406	hsa-miR-4652-3p	CLIP-seq
MIRT2471782	hsa-miR-4671-5p	CLIP-seq
MIRT2435281	hsa-miR-4672	CLIP-seq
MIRT1928407	hsa-miR-4735-5p	CLIP-seq
MIRT1928408	hsa-miR-4742-3p	CLIP-seq
MIRT2435282	hsa-miR-4756-3p	CLIP-seq
MIRT2169166	hsa-miR-4759	CLIP-seq
MIRT773879	hsa-miR-4768-3p	CLIP-seq
MIRT773880	hsa-miR-4777-3p	CLIP-seq
MIRT2471783	hsa-miR-4786-3p	CLIP-seq
MIRT773882	hsa-miR-4786-5p	CLIP-seq
MIRT2471784	hsa-miR-4799-5p	CLIP-seq
MIRT2169171	hsa-miR-484	CLIP-seq
MIRT773884	hsa-miR-485-5p	CLIP-seq
MIRT773887	hsa-miR-495	CLIP-seq
MIRT2471785	hsa-miR-496	CLIP-seq
MIRT2471786	hsa-miR-499-5p	CLIP-seq
MIRT2471787	hsa-miR-500a	CLIP-seq
MIRT2169175	hsa-miR-5095	CLIP-seq
MIRT773902	hsa-miR-522	CLIP-seq
MIRT773904	hsa-miR-544b	CLIP-seq
MIRT773905	hsa-miR-548a-5p	CLIP-seq
MIRT773906	hsa-miR-548ab	CLIP-seq
MIRT773909	hsa-miR-548ak	CLIP-seq
MIRT773910	hsa-miR-548b-5p	CLIP-seq
MIRT773911	hsa-miR-548c-3p	CLIP-seq
MIRT773912	hsa-miR-548c-5p	CLIP-seq
MIRT773913	hsa-miR-548d-5p	CLIP-seq
MIRT773914	hsa-miR-548h	CLIP-seq
MIRT773915	hsa-miR-548i	CLIP-seq
MIRT773916	hsa-miR-548j	CLIP-seq
MIRT2471789	hsa-miR-548n	CLIP-seq
MIRT773919	hsa-miR-548s	CLIP-seq
MIRT773920	hsa-miR-548w	CLIP-seq
MIRT773921	hsa-miR-548y	CLIP-seq
MIRT773922	hsa-miR-559	CLIP-seq
MIRT2471790	hsa-miR-601	CLIP-seq
MIRT2471791	hsa-miR-605	CLIP-seq
MIRT773925	hsa-miR-612	CLIP-seq
MIRT773927	hsa-miR-622	CLIP-seq
MIRT773933	hsa-miR-769-5p	CLIP-seq
MIRT773936	hsa-miR-875-3p	CLIP-seq
MIRT2471792	hsa-miR-875-5p	CLIP-seq
MIRT773938	hsa-miR-98	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
AIP	Activation	11469723
ARNT	Unknown	18540824
ESR1	Unknown	10620335
ESRRA	Unknown	10620335
SMAD2	Unknown	11259615
SMAD3	Unknown	11259615
SMAD4	Unknown	11259615
SP1	Repression	16410262

Show/Hide all (69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IBA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	15681594
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	23275542
GO:0001094	Function	TFIID-class transcription factor complex binding	IPI	15641800
GO:0001223	Function	Transcription coactivator binding	IPI	15641800
GO:0001568	Process	Blood vessel development	NAS	19538249
GO:0002819	Process	Regulation of adaptive immune response	IDA	32818467
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	32818467
GO:0003677	Function	DNA binding	IDA	15681594
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	8246913, 19538249
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11782478, 28602820
GO:0003700	Function	DNA-binding transcription factor activity	NAS	9170146
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	34521881
GO:0004879	Function	Nuclear receptor activity	IDA	10395741, 28602820, 32818467, 32866000
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	9079689, 9704006, 10395741, 16257957, 28514442, 28602820, 33961781, 34521881
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	28602820, 32866000, 34521881
GO:0005634	Component	Nucleus	IDA	10395741, 15681594, 17329248, 23275542, 32818467
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8246913
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	TAS	19538249
GO:0005737	Component	Cytoplasm	IDA	15681594, 32818467
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	17329248
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	10395741
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	15681594, 32818467
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	TAS	19538249
GO:0006915	Process	Apoptotic process	TAS	12213388
GO:0009410	Process	Response to xenobiotic stimulus	IDA	7961644, 34521881
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009636	Process	Response to toxic substance	IDA	7961644
GO:0010468	Process	Regulation of gene expression	IDA	15681594
GO:0017025	Function	TBP-class protein binding	IPI	15641800
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0030888	Process	Regulation of B cell proliferation	IDA	15681594
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IMP	15641800
GO:0034751	Component	Aryl hydrocarbon receptor complex	IBA
GO:0034752	Component	Cytosolic aryl hydrocarbon receptor complex	TAS	19538249
GO:0034753	Component	Nuclear aryl hydrocarbon receptor complex	IDA	34521881
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	32818467, 34521881
GO:0046982	Function	Protein heterodimerization activity	IDA	28602820, 34521881
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IDA	24367025, 29454749
GO:0050728	Process	Negative regulation of inflammatory response	IDA	29454749
GO:0051879	Function	Hsp90 protein binding	IDA	9079689
GO:0060729	Process	Intestinal epithelial structure maintenance	IDA	29454749
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	9079689
GO:0070888	Function	E-box binding	ISS
GO:0071219	Process	Cellular response to molecule of bacterial origin	IDA	29454749
GO:0071320	Process	Cellular response to cAMP	IDA	17329248
GO:1904322	Process	Cellular response to forskolin	IDA	17329248
GO:1904613	Process	Cellular response to 2,3,7,8-tetrachlorodibenzodioxine	IDA	17329248
GO:1904613	Process	Cellular response to 2,3,7,8-tetrachlorodibenzodioxine	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28602820, 34521881

MIM	HGNC	e!Ensembl
600253	348	ENSG00000106546

P35869

Protein name

Aryl hydrocarbon receptor (Ah receptor) (AhR) (Class E basic helix-loop-helix protein 76) (bHLHe76)

Protein function

Ligand-activated transcription factor that enables cells to adapt to changing conditions by sensing compounds from the environment, diet, microbiome and cellular metabolism, and which plays important roles in development, immunity and cancer (Pu

PDB

5NJ8 , 7ZUB , 8QMO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	35 → 80	Helix-loop-helix DNA-binding domain	Domain
PF00989	PAS	113 → 227	PAS fold	Domain
PF08447	PAS_3	297 → 383	PAS fold	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle. Expressed in retinal photoreceptors (PubMed:29726989). {ECO:0000269|PubMed:29726989, ECO:0000269|PubMed:7515333, ECO:0000

Sequence

MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL

Sequence length

848

Interactions

View interactions

	KEGG		Reactome
	Th17 cell differentiation Cushing syndrome Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species		PPARA activates gene expression Phase I - Functionalization of compounds Endogenous sterols Xenobiotics Aryl hydrocarbon receptor signalling

107

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Foveal hypoplasia 3	Likely pathogenic; Pathogenic	rs1562482694	RCV004731033	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Infantile nystagmus with foveal hypoplasia	Likely pathogenic; Pathogenic	rs1562482694	RCV000786023	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinitis pigmentosa 85	Pathogenic	rs1562481438	RCV000758221	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (104)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AHR-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE RESORPTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONOBIOLOGY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL NYSTAGMUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GH-secreting pituitary adenoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NYSTAGMUS, CONGENITAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CANCER, ADULT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PATENT DUCTUS VENOSUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRURITUS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ARTERIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal dystrophy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CALCULI	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER STONE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (470)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	BEFREE	24521362, 25019383, 26963951, 30488289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	33281746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	30144817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	31606043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16410262, 28555259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	21226706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	22754483, 30158248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	21262915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	31519687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17127240, 22273977, 24023334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17200336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10503953, 17127240, 19358281, 21996739, 22273977, 23229511, 23855798, 28351761, 28854564, 29229632, 29704546, 30473538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	12597446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	11342781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16410262, 28555259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25769544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22311706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	12480531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	12480531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24106308, 25186463, 29481912		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	10656108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	24049053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29186269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12852830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28476168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	28782227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30785917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	25620626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	25620626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	22337624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	30474833		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31609478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28671964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15531779, 21441140, 26307030, 30508524, 31638212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23982178, 29524589, 29666259, 29884199, 31722204, 31811747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	28935693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23036591, 23349129, 24309559, 26838552, 28403070, 28535889, 30418118, 32245307, 34302046, 34944003, 35309329, 35943876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11734432, 15302769, 22561122, 24365139, 24469321, 26938767, 29672862, 30982974, 31647966, 9661675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22053597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15531779, 21441140, 26307030, 30508524, 31638212		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	22228805		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	23037589, 26307030, 33167400	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31682211		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18362914, 22649193, 22749494, 23942720, 23975386, 23982178, 28602820, 28615443, 29343438, 29672155, 29884199, 30143013, 30214937, 30289282, 30316103 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24749687, 28424418, 33668313, 35309329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	17559847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24749687	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	25045206, 29149781		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	CTD_human_DG	25045206		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	25045206, 29149781	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	22037238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21684673		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	32763163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11866883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	34944003	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bowen's Disease		Pubtator	30144817	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21976023, 22371237, 23909806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	29667084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11408954, 11597580, 12612060, 16103451, 16538170, 16569260, 16721748, 16972784, 17599377, 18001219, 18059014, 18955032, 19270430, 19901195, 20032195 View all (45 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21515334, 22296396		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10922479, 16569260, 17140257, 17599377, 19604390, 20130088, 20631324, 20651249, 20804740, 20846786, 21454829, 21486221, 21640702, 22296395, 22596188 View all (34 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18824009, 25150061, 27103661, 28192119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	27103661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15111621, 19056653, 19138996, 19360915, 19371443, 22311706, 22592002, 22728919, 24736433, 25550834, 27586240, 28601309, 29320557, 30813617, 31996203 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24330582, 28424418, 28878246, 30066859, 34198826, 34769098, 35692498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11866883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11698344, 15093676, 17127240, 17174437, 18818557, 21996739, 22037483, 22993405, 25447411, 27060206, 27752740, 29262847, 29704546, 29921510, 30563036, 31462083, 31682781, 7550366 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37685961	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24916699, 33390778, 38268058, 39336758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30144817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	11342781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11756572, 31212758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24737285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26860885, 28490014, 29984241, 31216422, 31488157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32244284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29075781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	30778350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	27280500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25359166, 31470811, 31606043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	16410262, 24052107, 28555259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22311706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	21666223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	29395338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26860885, 28490014, 28992067, 29163188, 29167396, 29395338, 30324315, 30336612, 30912928, 30959953, 31488157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24469321, 26408075, 28749959, 30563036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	24092408, 28689792, 29605298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	29605298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology Disorders	CTD_human_DG	23291558		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Circadian Rhythm Disorders	Circadian Rhythm Disorders	CTD_human_DG	23291558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	25523818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	26000313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	30294794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29197979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20231854, 20878756, 21321579, 21374063, 23928874, 27900483, 28049094, 28113104, 28399013, 29166616, 29207040, 29449535, 29483826, 29576052, 29680209, 30166541, 31029423, 31031628 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	CTD_human_DG	27783946		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	36732664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21374063, 25447411, 26514676, 26973338, 27262846, 28601309, 29017096, 31621310, 31675361, 9783729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	18268115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21081473, 26514676, 28601309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25335079, 26515162, 28601309, 30720065, 31675361, 36148682, 38317509, 38556263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37750623	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Cold	Common cold	Pubtator	34446714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	CTD_human_DG	19261855		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Heart Defects	Congenital heart defects	BEFREE	31699484, 31837856		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Congenital Heart Disease	BEFREE	29185192		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital nystagmus	Congenital nystagmus	CTD_human_DG	23301081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25523818, 31488157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30696585, 31676204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25620626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28481916, 31676204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	31501353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29185192, 29449662, 31676204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	19360915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	29605298, 30609423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27598741, 30098863, 31405308, 31693091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	22648180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	GWASCAT_DG	26237428, 30429480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29670460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24635637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	12852830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	12852830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31017816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	23949496, 24909886, 28595996, 30503244, 31269229, 31358547, 31394397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	23348739, 28703805, 29866992, 31868801, 33321923, 34299118, 35163694, 39923831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	23348739, 27129092, 27869817, 28057434, 28703805, 29972223, 30499126, 30578876, 31344386, 31358547, 31683543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	23448877, 23949496, 24909886, 26061570, 26269144, 28941474, 28973351, 29462476, 29857917, 29972223, 30785917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	27942866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29802768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35618242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29802768, 30488289, 31326077, 31712674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32849564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26002927, 28061820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	18515748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25769544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	27842700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	32763163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	CTD_human_DG	21890736		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	BEFREE	23348739, 27129092, 27869817, 28057434, 28703805, 29972223, 30499126, 30578876, 31344386, 31358547, 31683543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10822009, 16257430, 23208493, 24817304, 28782227, 30953668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24817304, 28782227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10724351, 11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	11756572, 12200463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	16084889, 27348627, 33693877, 34155552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	16409204, 28042058, 29581487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36070107, 36456979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36070107, 37968758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	27977510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	27977510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	27842700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	11342781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20303349, 20831858, 28238261, 28821316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20303349, 27108252, 30944419, 31465774, 31730885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	27769811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24154488, 31170413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	29416063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	19360915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	19360915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19690180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	28393368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	27108252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	36754954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19465936, 26500056, 26651356, 28318896, 30962630, 31128300, 31171720, 31197266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26651356, 29667084, 32611766, 34082239, 37233762, 38068712, 38458072, 40471422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19465936, 26500056, 26651356, 28318896, 30962630, 31128300, 31171720, 31197266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22539616, 23909806, 26654773, 29667084, 31505164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27586240, 29667084, 37233762, 38091354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38068712	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	24106308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31393854	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	36056390	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	29146461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	25120780	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	27842700, 32439897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	24521362, 27998805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	21104991, 22912337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22912337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	29449662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16410262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	20171126, 30388136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	26925780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	32663496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	24330582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	24330582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21640702, 25550834, 29320557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	12107286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Horizontal pendular nystagmus	Horizontal pendular nystagmus	BEFREE	31009037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyaline Membrane Disease	Hyaline Membrane Disease	BEFREE	30616641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	16636061, 30790002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	36368943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18515748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	25620626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	25620626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	18824009, 21906671, 25831079, 27103661, 37884440	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	22871890, 27977510	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	18212270, 27442426, 27977510, 28956952, 30127255, 31489946		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	21115475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	BEFREE	22727790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	30616641		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	22648180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31712674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17140257, 17599377, 20228066, 24721792, 27448695, 32978975	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19695250, 26852918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28956952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28475713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29197979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	17559847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21600206, 27158904, 28399013, 28469075, 28547076, 29483826, 29672155, 29680209, 31666808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	39684781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	29735912, 30899591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	23949496, 24909886, 28595996, 31269229, 31394397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	19360915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	27598741, 30778350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	29737914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	27900579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	15845371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	29588546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12538453, 31488157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	29305091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37510393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	25218365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	CTD_human_DG	14644620, 31016362		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	31016362		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyoma	Leiomyoma	Pubtator	36375056, 37607000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20171126, 21262915, 22166497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30091999, 35371054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21262915, 22754483, 23656719, 32422910, 33709099, 34568834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38404179	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22754483, 28656088, 29344132, 30158248, 30917715, 31519687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12480531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30015848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10398686, 11064004, 11147830, 12377985, 12392715, 16109480, 16257430, 20817071, 24481452, 25637755, 27283490, 27959388, 28398627, 28424418, 29222397 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	22166890, 30740944	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	29416063		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30740944		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure Acute	Liver failure	Pubtator	27531059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	27531059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10398686, 11064004, 11147830, 12377985, 12392715, 15845371, 16109480, 16257430, 20817071, 24481452, 25637755, 27959388, 29222397, 30098559, 30569404, 31479813, 31588062, 8074712 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	19996281, 30346592		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	LHGDN	15863442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	15863442, 34446714, 35203356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28273093, 28351761, 29670460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18818557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20190398, 24132637, 24657910, 35101137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22993405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29262847, 37151890	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26354876, 30289282, 36314527, 39212542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28336124, 30289282, 30396745, 30743201, 31318609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17823287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28461126, 31035533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16985026, 19759200, 19821039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	16985026, 19759200, 19821039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29317604, 30513921, 31012492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of lower limb	Malignant melanoma of skin	GWASCAT_DG	26237428, 30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of upper limb	Malignant melanoma of skin	GWASCAT_DG	26237428, 30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	29302888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11408954, 11597580, 12612060, 16103451, 16538170, 16569260, 16721748, 16972784, 17599377, 18001219, 18059014, 18955032, 19270430, 19901195, 20032195 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21515334, 22296396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10822009, 16257430, 24817304, 28782227, 30953668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19690180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	25139457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18708364, 24330582, 28878246, 30346592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19996281, 30346592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11698344, 15093676, 17127240, 17174437, 18818557, 21996739, 22037483, 22993405, 25447411, 27060206, 27752740, 29262847, 29704546, 29921510, 30563036, 31462083, 31682781, 7550366 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30015848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11756572, 31212758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	12203118, 25826687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29758193, 31609478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11891538, 15026081, 19270430, 20140206, 21802500, 23831623, 24755659, 26476001, 27448695, 28093676, 28972393, 30009782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	20140206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	30144817, 31552251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	12107286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16337337, 19360915, 19371443, 23604401, 29344254, 30087718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26392334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ureter	Malignant Neoplasm Of Ureter	CTD_human_DG	19755661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11866883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12480531, 1844873, 18652561, 19690180, 19755661, 20106901, 20140206, 21104991, 21976023, 22052373, 22993405, 23022626, 23208493, 23370907, 23942720 View all (46 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	22037238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29351992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25447411, 26514676, 26973338, 27262846, 28601309, 29017096, 31621310, 31675361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21515334, 22296396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14973392, 17311112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15210858, 21640702, 26715507, 26996297, 27144894, 28412963, 29320557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21515334, 22296396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21515334, 22296396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22311706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	22311706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15982688, 23843039, 30429474, 31552251		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	22815870, 27424798, 33114713, 34343493, 35048636, 36305167	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASCAT_DG	28212542		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	29739929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29302888, 29667084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	29667084, 33099292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31017816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31712674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	30240768, 31552251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	CTD_human_DG	25768209		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	27837601, 28595944, 30813227, 31417158, 31653699		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic syndrome	Pubtator	28878246, 31417158	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	33412808	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19737606, 26002927, 30057068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	27448695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micropenis	Micropenis	BEFREE	15758562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	25831079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	26593447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	28503784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36849997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	11342781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24798859, 30198908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24798859, 34232800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27671624, 28615443, 29358321, 29563571, 31026283, 31181469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33709099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16410262, 30091999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	30091999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	25620626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30696585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30696585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	24092408, 29605298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25337212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	39261077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11024287, 12612060, 16054739, 16091746, 16410262, 16972784, 18059014, 19138943, 19695250, 20106948, 21976023, 22311706, 22644306, 22912337, 23625689 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	22037238		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29197979, 29258844, 30718831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	25051309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22024478, 24586395, 31404492, 31431462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22024478, 24586395, 28860601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27671624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28042058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27713108, 31401392, 31730885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	29416063		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24023334, 27752740, 29229632, 30094095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	29416063		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31465774		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Norrie disease	Norrie Disease	BEFREE	29344132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	BEFREE	31009037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26002927, 28595944, 28821316, 30813227, 30831189		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	27020609, 30813227		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	32849564	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	23776235, 28007558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	24481452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30127998, 31847600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	38316181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	11455387		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11756572, 23696052, 31212758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25404385, 26561720, 31212758, 38316181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	23776235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic cancer, adult	Pancreatic cancer	CTD_human_DG	12203118		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29758193, 31609478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	12203118, 25826687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31609478, 37685961, 39947435	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	30165701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	27769811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25019383, 26392334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29197979, 30836878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32868381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	22648180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	BEFREE	15758562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28393368, 31032952, 31286538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nerve Sheath Neoplasm	Peripheral Nerve Sheath Neoplasm	BEFREE	29351992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	19556287, 23940012, 28649092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	28634910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	19556287, 31996203, 33281746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	27998805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	28649092	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	29351992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36368943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39381438	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	18268115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	11455387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	12852830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11891538, 15026081, 19270430, 20140206, 21802500, 23831623, 24755659, 26476001, 27448695, 28093676, 28972393, 30009782		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19270430, 23266674, 24755659, 25124584, 28671964, 29364159, 37077937	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	20140206		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23831623, 27448695	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28093676		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pruritus	Pruritus	Pubtator	39923831	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	24909886, 30499126, 31683543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	33804147, 34299118	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	30394267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychogenic Inversion of Circadian Rhythm	Circadian Rhythm Disorders	CTD_human_DG	23291558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31712674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	25139457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25523818, 31488157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29726989		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinitis Pigmentosa	Retinitis Pigmentosa	ORPHANET_DG	29726989		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinitis pigmentosa	Retinitis Pigmentosa	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinoblastoma	Retinoblastoma	Pubtator	20664703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18617548, 23349129, 23982178, 24309559, 26838552, 28007558, 28192119, 28403070, 28535889, 29096558, 30418118, 31594926, 31755636, 31811747		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	18617548		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	24514067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15459223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Abnormalities	Skin abnormalities	Pubtator	36574884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	29866992, 31868801, 34299118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	31594926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28595996, 30394267, 30743201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	30144817, 35169210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	30294794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	23768840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	21205295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	35101137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenic Diseases	Splenic Diseases	CTD_human_DG	20961953		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	33013906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	27144894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24023334, 30013037, 30144817, 31552251		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21678497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22912337, 23625689, 27509054, 34941188, 40532857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	GWASCAT_DG	27424798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30144817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22912337, 23625689		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29282471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20303349, 20831858, 25975270, 28238261, 28821316, 29416063, 29873790, 30448775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19360915, 19371443, 23604401, 29344254, 30087718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	12107286		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16337337		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	19360915	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	19371443, 22592002, 30266078, 31672612, 37138031	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	BEFREE	28547076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25569083, 30324315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	27842700, 31536596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26392334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26392334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26392334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24058584, 30445863, 30450577, 31253396, 31652854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32032581, 40318744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20231854, 27900483, 29449535		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	29317604, 30513921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	16636061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	31887800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ureteral Neoplasms	Ureteral Neoplasms	CTD_human_DG	19755661		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Calculi (disorder)	Urinary Bladder Calculi	CTD_human_DG	22232670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32907554, 32988402, 37670034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	35710704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19755661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19695250, 34784845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	29656117, 30090104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	28256612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	CTD_human_DG	25482063		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	BEFREE	29605671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	31344386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	22211302, 26370050, 29723348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	26370050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	26370050	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	29723348	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	22211302, 26370050, 29723348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	15459223		★★★★★ ★☆☆☆☆ Found in Text Mining only

AHR (aryl hydrocarbon receptor)