Gene Gene information from NCBI Gene database.
Entrez ID 195828
Gene name Zinc finger protein 367
Gene symbol ZNF367
Synonyms (NCBI Gene)
AFF29CDC14BZFF29
Chromosome 9
Chromosome location 9q22.32|9q22.32
miRNA miRNA information provided by mirtarbase database.
847
miRTarBase ID miRNA Experiments Reference
MIRT030794 hsa-miR-21-5p Sequencing 20371350
MIRT048609 hsa-miR-99a-5p CLASH 23622248
MIRT463172 hsa-miR-16-5p HITS-CLIP 21572407
MIRT463171 hsa-miR-15b-5p HITS-CLIP 21572407
MIRT463170 hsa-miR-6838-5p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IDA 15344908
GO:0005634 Component Nucleus IDA 15344908
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610160 18320 ENSG00000165244
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7RTV3
Protein name Zinc finger protein 367 (C2H2 zinc finger protein ZFF29)
Protein function Transcriptional activator. Isoform 1 may be involved in transcriptional activation of erythroid genes.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13912 zf-C2H2_6 168 192 Domain
PF00096 zf-C2H2 195 219 Zinc finger, C2H2 type Domain
Sequence
MIRGFEAPMAENPPPPPPPVIFCHDSPKRVLVSVIRTTPIKPTCGGGGEPEPPPPLIPTS
PGFSDFMVYPWRWGENAHNVTLSPGAAGAAASAALPAAAAAEHSGLRGRGAPPPAASASA
AASGGEDEEEASSPDSGHLKDGIRRGRPRADTVRDLINEGEHSSSRIRCNICNRVFPREK
SLQAHKRTHTGE
RPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSENGCLSRFTHAN
RHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWEMREQRTPTLKGKLVQKADQE
QQDPLEYLQSDEEDDEKRGAQRRLQEQRERLHGALALIELANLTGAPLRQ
Sequence length 350
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLORECTAL NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS, CASTRATION-RESISTANT CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Astrocytoma Astrocytoma BEFREE 22525274
★☆☆☆☆
Found in Text Mining only
Benign Neoplasm Benign Neoplasm BEFREE 25047265
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 28036274, 31638237, 32549756, 33378938 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 30570867 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 37185598 Associate
★☆☆☆☆
Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma Renal Carcinoma BEFREE 24619757
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 22525274
★☆☆☆☆
Found in Text Mining only
Glioblastoma Multiforme Glioblastoma BEFREE 22525274
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 37185598 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of thyroid Thyroid cancer BEFREE 25047265
★☆☆☆☆
Found in Text Mining only