Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	195814
Gene name	Short chain dehydrogenase/reductase family 16C member 5
Gene symbol	SDR16C5
Synonyms (NCBI Gene)	EPHD-2RDH#2RDH-E2RDHE2retSDR2
Chromosome	8
Chromosome location	8q12.1
Summary	This gene encodes a member of the short-chain alcohol dehydrogenase/reductase superfamily of proteins and is involved in the oxidation of retinol to retinaldehyde. The encoded protein is associated with the endoplasmic reticulum and is predicted to contai

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018359	hsa-miR-335-5p	Microarray	18185580
MIRT534448	hsa-miR-330-3p	PAR-CLIP	22012620
MIRT534447	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT534446	hsa-miR-4422	PAR-CLIP	22012620
MIRT534445	hsa-miR-216a-5p	PAR-CLIP	22012620
MIRT534444	hsa-miR-216b-5p	PAR-CLIP	22012620
MIRT534443	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT534442	hsa-miR-5695	PAR-CLIP	22012620
MIRT534441	hsa-miR-515-5p	PAR-CLIP	22012620
MIRT534440	hsa-miR-519e-5p	PAR-CLIP	22012620
MIRT534439	hsa-miR-1202	PAR-CLIP	22012620
MIRT534438	hsa-miR-3972	PAR-CLIP	22012620
MIRT534436	hsa-miR-5006-5p	PAR-CLIP	22012620
MIRT534437	hsa-miR-4776-3p	PAR-CLIP	22012620
MIRT534448	hsa-miR-330-3p	PAR-CLIP	22012620
MIRT534447	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT534446	hsa-miR-4422	PAR-CLIP	22012620
MIRT534445	hsa-miR-216a-5p	PAR-CLIP	22012620
MIRT534444	hsa-miR-216b-5p	PAR-CLIP	22012620
MIRT534443	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT534442	hsa-miR-5695	PAR-CLIP	22012620
MIRT534441	hsa-miR-515-5p	PAR-CLIP	22012620
MIRT534440	hsa-miR-519e-5p	PAR-CLIP	22012620
MIRT534439	hsa-miR-1202	PAR-CLIP	22012620
MIRT534438	hsa-miR-3972	PAR-CLIP	22012620
MIRT534436	hsa-miR-5006-5p	PAR-CLIP	22012620
MIRT534437	hsa-miR-4776-3p	PAR-CLIP	22012620
MIRT1332051	hsa-miR-151-3p	CLIP-seq
MIRT1332052	hsa-miR-3163	CLIP-seq
MIRT1332053	hsa-miR-4282	CLIP-seq
MIRT1332054	hsa-miR-4641	CLIP-seq
MIRT1332055	hsa-miR-4753-3p	CLIP-seq
MIRT1332056	hsa-miR-4768-5p	CLIP-seq
MIRT1332057	hsa-miR-487a	CLIP-seq
MIRT1332058	hsa-miR-513c	CLIP-seq
MIRT1332059	hsa-miR-514b-5p	CLIP-seq
MIRT2322853	hsa-miR-323-3p	CLIP-seq
MIRT2322854	hsa-miR-3609	CLIP-seq
MIRT2322855	hsa-miR-3616-3p	CLIP-seq
MIRT2322856	hsa-miR-4436b-3p	CLIP-seq
MIRT2322857	hsa-miR-4502	CLIP-seq
MIRT2322858	hsa-miR-4721	CLIP-seq
MIRT2322859	hsa-miR-548ah	CLIP-seq
MIRT2459004	hsa-miR-3653	CLIP-seq
MIRT2459005	hsa-miR-3973	CLIP-seq
MIRT2459006	hsa-miR-520g	CLIP-seq
MIRT2459007	hsa-miR-520h	CLIP-seq
MIRT2459008	hsa-miR-548a-5p	CLIP-seq
MIRT2459009	hsa-miR-548ab	CLIP-seq
MIRT2459010	hsa-miR-548ak	CLIP-seq
MIRT2459011	hsa-miR-548b-5p	CLIP-seq
MIRT2459012	hsa-miR-548c-5p	CLIP-seq
MIRT2459013	hsa-miR-548d-5p	CLIP-seq
MIRT2459014	hsa-miR-548h	CLIP-seq
MIRT2459015	hsa-miR-548i	CLIP-seq
MIRT2459016	hsa-miR-548j	CLIP-seq
MIRT2459017	hsa-miR-548w	CLIP-seq
MIRT2459018	hsa-miR-548y	CLIP-seq
MIRT2459019	hsa-miR-559	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	16691198
GO:0000785	Component	Chromatin	IDA	16691198
GO:0003714	Function	Transcription corepressor activity	IDA	16691198
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IBA
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IDA	18926804, 19102727
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IEA
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	16691198
GO:0005783	Component	Endoplasmic reticulum	IDA	16691198
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	18926804
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005811	Component	Lipid droplet	IBA
GO:0005886	Component	Plasma membrane	IDA	16691198
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0017053	Component	Transcription repressor complex	IDA	16691198
GO:0042572	Process	Retinol metabolic process	IBA
GO:0042572	Process	Retinol metabolic process	IDA	18926804, 19102727
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042574	Process	Retinal metabolic process	IBA
GO:0042574	Process	Retinal metabolic process	IDA	18926804, 19102727
GO:0043616	Process	Keratinocyte proliferation	IMP	12372410
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IDA	16691198
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16691198
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16691198

MIM	HGNC	e!Ensembl
608989	30311	ENSG00000170786

Q8N3Y7

Protein name

Epidermal retinol dehydrogenase 2 (EPHD-2) (RDH-E2) (EC 1.1.1.105) (Retinal short-chain dehydrogenase reductase 2) (retSDR2) (Short-chain dehydrogenase/reductase family 16C member 5)

Protein function

Oxidoreductase with strong preference for NAD (PubMed:18926804). Active in both the oxidative and reductive directions (PubMed:18926804). Oxidizes all-trans-retinol in all-trans-retinaldehyde (PubMed:18926804). No activity was detected with 11-c

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00106	adh_short	41 → 238	short chain dehydrogenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in adult lung. Detected at low levels in adult brain, heart, testis, placenta, cervix, pancreas, uterus, stomach, rectum, small intestine, colon, esophagus, thymus, skin, and skin keratinocyte. Expression is higher in psoriasi

Sequence

MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQF
ARLGSVLVLWDINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVS
ILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAG
LSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCTTGCPS
LLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMD
GFVDQKKKL

Sequence length

309

Interactions

View interactions

	KEGG		Reactome
	Retinol metabolism Metabolic pathways Biosynthesis of cofactors		RA biosynthesis pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36033826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33815409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33879671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SDR16C5 (short chain dehydrogenase/reductase family 16C member 5)