EFNB2 (ephrin B2)

Gene

• Entrez ID: 1948
• Gene name: Ephrin B2
• Gene symbol: EFNB2
• Synonyms (NCBI Gene): EPLG5, HTKL, Htk-L, LERK5, ephrin-B2
• Chromosome: 13
• Chromosome location: 13q33.3
• Summary: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006337	hsa-miR-20b-5p	Luciferase reporter assay	22438230
MIRT006337	hsa-miR-20b-5p	Luciferase reporter assay	22438230
MIRT006337	hsa-miR-20b-5p	Luciferase reporter assay	22438230
MIRT007101	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	23204229
MIRT007101	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	23204229
MIRT020031	hsa-miR-375	Microarray	20215506
MIRT024211	hsa-miR-218-5p	Sequencing	20371350
MIRT024662	hsa-miR-215-5p	Microarray	19074876
MIRT026948	hsa-miR-192-5p	Microarray	19074876
MIRT027181	hsa-miR-103a-3p	Sequencing	20371350
MIRT027920	hsa-miR-96-5p	Sequencing	20371350
MIRT032048	hsa-miR-16-5p	Proteomics	18668040
MIRT043356	hsa-miR-331-3p	CLASH	23622248
MIRT438381	hsa-miR-582-5p	Luciferase reporter assay, Western blot, qRT-PCR	25176332
MIRT438381	hsa-miR-582-5p	Luciferase reporter assay, Western blot, qRT-PCR	25176332
MIRT438381	hsa-miR-582-5p	Luciferase reporter assay, Western blot, qRT-PCR	25176332
MIRT438381	hsa-miR-582-5p	Luciferase reporter assay, Western blot, qRT-PCR	25176332
MIRT537820	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT537819	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT537818	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT537817	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT537816	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT032048	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT537815	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT537814	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT537813	hsa-miR-3662	PAR-CLIP	20371350
MIRT572103	hsa-miR-8066	PAR-CLIP	20371350
MIRT537812	hsa-miR-646	PAR-CLIP	20371350
MIRT537811	hsa-miR-3163	PAR-CLIP	20371350
MIRT537809	hsa-miR-924	PAR-CLIP	20371350
MIRT537808	hsa-miR-8077	PAR-CLIP	20371350
MIRT537807	hsa-miR-3689a-5p	PAR-CLIP	20371350
MIRT537806	hsa-miR-3689b-5p	PAR-CLIP	20371350
MIRT537805	hsa-miR-3689e	PAR-CLIP	20371350
MIRT537804	hsa-miR-3689f	PAR-CLIP	20371350
MIRT537803	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT537802	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT537800	hsa-miR-627-5p	PAR-CLIP	20371350
MIRT537798	hsa-miR-3161	PAR-CLIP	20371350
MIRT537820	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT537819	hsa-miR-503-5p	PAR-CLIP	22012620
MIRT537818	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT537817	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT537816	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT032048	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT537815	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT537814	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT537813	hsa-miR-3662	PAR-CLIP	22012620
MIRT537812	hsa-miR-646	PAR-CLIP	22012620
MIRT537811	hsa-miR-3163	PAR-CLIP	22012620
MIRT537810	hsa-miR-339-5p	PAR-CLIP	22012620
MIRT537809	hsa-miR-924	PAR-CLIP	22012620
MIRT537808	hsa-miR-8077	PAR-CLIP	22012620
MIRT537807	hsa-miR-3689a-5p	PAR-CLIP	22012620
MIRT537806	hsa-miR-3689b-5p	PAR-CLIP	22012620
MIRT537805	hsa-miR-3689e	PAR-CLIP	22012620
MIRT537804	hsa-miR-3689f	PAR-CLIP	22012620
MIRT537803	hsa-miR-4524a-5p	PAR-CLIP	22012620
MIRT537802	hsa-miR-4524b-5p	PAR-CLIP	22012620
MIRT537801	hsa-miR-670-5p	PAR-CLIP	22012620
MIRT537800	hsa-miR-627-5p	PAR-CLIP	22012620
MIRT537798	hsa-miR-3161	PAR-CLIP	22012620
MIRT537799	hsa-miR-4755-5p	PAR-CLIP	22012620
MIRT537797	hsa-miR-5006-3p	PAR-CLIP	22012620
MIRT537796	hsa-miR-4446-5p	PAR-CLIP	22012620
MIRT537820	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT537819	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT537818	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT537817	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT537816	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT032048	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT537815	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT537814	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT537813	hsa-miR-3662	PAR-CLIP	20371350
MIRT572103	hsa-miR-8066	PAR-CLIP	20371350
MIRT537812	hsa-miR-646	PAR-CLIP	20371350
MIRT537811	hsa-miR-3163	PAR-CLIP	20371350
MIRT537809	hsa-miR-924	PAR-CLIP	20371350
MIRT537808	hsa-miR-8077	PAR-CLIP	20371350
MIRT537807	hsa-miR-3689a-5p	PAR-CLIP	20371350
MIRT537806	hsa-miR-3689b-5p	PAR-CLIP	20371350
MIRT537805	hsa-miR-3689e	PAR-CLIP	20371350
MIRT537804	hsa-miR-3689f	PAR-CLIP	20371350
MIRT537803	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT537802	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT537800	hsa-miR-627-5p	PAR-CLIP	20371350
MIRT537798	hsa-miR-3161	PAR-CLIP	20371350
MIRT537820	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT537819	hsa-miR-503-5p	PAR-CLIP	22012620
MIRT537818	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT537817	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT537816	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT032048	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT537815	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT537814	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT537813	hsa-miR-3662	PAR-CLIP	22012620
MIRT537812	hsa-miR-646	PAR-CLIP	22012620
MIRT537811	hsa-miR-3163	PAR-CLIP	22012620
MIRT537810	hsa-miR-339-5p	PAR-CLIP	22012620
MIRT537809	hsa-miR-924	PAR-CLIP	22012620
MIRT537808	hsa-miR-8077	PAR-CLIP	22012620
MIRT537807	hsa-miR-3689a-5p	PAR-CLIP	22012620
MIRT537806	hsa-miR-3689b-5p	PAR-CLIP	22012620
MIRT537805	hsa-miR-3689e	PAR-CLIP	22012620
MIRT537804	hsa-miR-3689f	PAR-CLIP	22012620
MIRT537803	hsa-miR-4524a-5p	PAR-CLIP	22012620
MIRT537802	hsa-miR-4524b-5p	PAR-CLIP	22012620
MIRT537801	hsa-miR-670-5p	PAR-CLIP	22012620
MIRT537800	hsa-miR-627-5p	PAR-CLIP	22012620
MIRT537798	hsa-miR-3161	PAR-CLIP	22012620
MIRT537799	hsa-miR-4755-5p	PAR-CLIP	22012620
MIRT537797	hsa-miR-5006-3p	PAR-CLIP	22012620
MIRT537796	hsa-miR-4446-5p	PAR-CLIP	22012620
MIRT954232	hsa-miR-1	CLIP-seq
MIRT954233	hsa-miR-101	CLIP-seq
MIRT954234	hsa-miR-128	CLIP-seq
MIRT954235	hsa-miR-134	CLIP-seq
MIRT954236	hsa-miR-144	CLIP-seq
MIRT954237	hsa-miR-1470	CLIP-seq
MIRT954238	hsa-miR-206	CLIP-seq
MIRT954239	hsa-miR-27a	CLIP-seq
MIRT954240	hsa-miR-27b	CLIP-seq
MIRT954241	hsa-miR-3074-5p	CLIP-seq
MIRT954242	hsa-miR-3118	CLIP-seq
MIRT954243	hsa-miR-3119	CLIP-seq
MIRT954244	hsa-miR-3164	CLIP-seq
MIRT954245	hsa-miR-3190	CLIP-seq
MIRT954246	hsa-miR-3673	CLIP-seq
MIRT954247	hsa-miR-3920	CLIP-seq
MIRT954248	hsa-miR-4326	CLIP-seq
MIRT954249	hsa-miR-4491	CLIP-seq
MIRT954250	hsa-miR-4501	CLIP-seq
MIRT954251	hsa-miR-4657	CLIP-seq
MIRT954252	hsa-miR-4659a-3p	CLIP-seq
MIRT954253	hsa-miR-4659b-3p	CLIP-seq
MIRT954254	hsa-miR-4667-3p	CLIP-seq
MIRT954255	hsa-miR-494	CLIP-seq
MIRT954256	hsa-miR-5096	CLIP-seq
MIRT954257	hsa-miR-513a-5p	CLIP-seq
MIRT954258	hsa-miR-562	CLIP-seq
MIRT954259	hsa-miR-576-3p	CLIP-seq
MIRT954260	hsa-miR-613	CLIP-seq
MIRT954261	hsa-miR-617	CLIP-seq
MIRT954262	hsa-miR-642a	CLIP-seq
MIRT1982570	hsa-miR-153	CLIP-seq
MIRT1982571	hsa-miR-3120-3p	CLIP-seq
MIRT1982572	hsa-miR-3127-3p	CLIP-seq
MIRT1982573	hsa-miR-3652	CLIP-seq
MIRT1982574	hsa-miR-3679-3p	CLIP-seq
MIRT1982575	hsa-miR-3942-3p	CLIP-seq
MIRT1982576	hsa-miR-409-5p	CLIP-seq
MIRT1982577	hsa-miR-412	CLIP-seq
MIRT1982578	hsa-miR-4318	CLIP-seq
MIRT1982579	hsa-miR-4430	CLIP-seq
MIRT1982580	hsa-miR-4474-3p	CLIP-seq
MIRT1982581	hsa-miR-448	CLIP-seq
MIRT1982582	hsa-miR-4505	CLIP-seq
MIRT1982583	hsa-miR-450b-5p	CLIP-seq
MIRT1982584	hsa-miR-4693-5p	CLIP-seq
MIRT1982585	hsa-miR-4699-3p	CLIP-seq
MIRT1982586	hsa-miR-4796-5p	CLIP-seq
MIRT1982587	hsa-miR-507	CLIP-seq
MIRT1982588	hsa-miR-518a-5p	CLIP-seq
MIRT1982589	hsa-miR-527	CLIP-seq
MIRT1982590	hsa-miR-557	CLIP-seq
MIRT1982591	hsa-miR-892a	CLIP-seq
MIRT954233	hsa-miR-101	CLIP-seq
MIRT2217437	hsa-miR-1202	CLIP-seq
MIRT2217438	hsa-miR-122	CLIP-seq
MIRT2217439	hsa-miR-1250	CLIP-seq
MIRT2217440	hsa-miR-1273f	CLIP-seq
MIRT2217441	hsa-miR-1321	CLIP-seq
MIRT2217442	hsa-miR-143	CLIP-seq
MIRT954236	hsa-miR-144	CLIP-seq
MIRT2217443	hsa-miR-15a	CLIP-seq
MIRT2217444	hsa-miR-15b	CLIP-seq
MIRT2217445	hsa-miR-16	CLIP-seq
MIRT2217446	hsa-miR-193a-3p	CLIP-seq
MIRT2217447	hsa-miR-193b	CLIP-seq
MIRT2217448	hsa-miR-195	CLIP-seq
MIRT2217449	hsa-miR-197	CLIP-seq
MIRT2217450	hsa-miR-19a	CLIP-seq
MIRT2217451	hsa-miR-19b	CLIP-seq
MIRT2217452	hsa-miR-200b	CLIP-seq
MIRT2217453	hsa-miR-200c	CLIP-seq
MIRT2217454	hsa-miR-218	CLIP-seq
MIRT2217455	hsa-miR-3065-3p	CLIP-seq
MIRT2217456	hsa-miR-3117-5p	CLIP-seq
MIRT1982571	hsa-miR-3120-3p	CLIP-seq
MIRT2217457	hsa-miR-3130-3p	CLIP-seq
MIRT2217458	hsa-miR-3135b	CLIP-seq
MIRT2217459	hsa-miR-3137	CLIP-seq
MIRT2217460	hsa-miR-3152-3p	CLIP-seq
MIRT2217461	hsa-miR-3194-5p	CLIP-seq
MIRT2217462	hsa-miR-346	CLIP-seq
MIRT1982573	hsa-miR-3652	CLIP-seq
MIRT2217463	hsa-miR-3657	CLIP-seq
MIRT2217464	hsa-miR-3682-5p	CLIP-seq
MIRT2217465	hsa-miR-3687	CLIP-seq
MIRT2217466	hsa-miR-369-3p	CLIP-seq
MIRT2217467	hsa-miR-384	CLIP-seq
MIRT2217468	hsa-miR-3922-5p	CLIP-seq
MIRT2217469	hsa-miR-3972	CLIP-seq
MIRT1982577	hsa-miR-412	CLIP-seq
MIRT2217470	hsa-miR-424	CLIP-seq
MIRT2217471	hsa-miR-4269	CLIP-seq
MIRT2217472	hsa-miR-429	CLIP-seq
MIRT2217473	hsa-miR-4297	CLIP-seq
MIRT1982578	hsa-miR-4318	CLIP-seq
MIRT2217474	hsa-miR-4420	CLIP-seq
MIRT2217475	hsa-miR-4423-5p	CLIP-seq
MIRT1982579	hsa-miR-4430	CLIP-seq
MIRT2217476	hsa-miR-4442	CLIP-seq
MIRT2217477	hsa-miR-4477b	CLIP-seq
MIRT954249	hsa-miR-4491	CLIP-seq
MIRT2217478	hsa-miR-4514	CLIP-seq
MIRT2217479	hsa-miR-4520a-3p	CLIP-seq
MIRT2217480	hsa-miR-4520b-3p	CLIP-seq
MIRT2217481	hsa-miR-4527	CLIP-seq
MIRT2217482	hsa-miR-455-5p	CLIP-seq
MIRT954251	hsa-miR-4657	CLIP-seq
MIRT2217483	hsa-miR-4692	CLIP-seq
MIRT1982584	hsa-miR-4693-5p	CLIP-seq
MIRT2217484	hsa-miR-4695-3p	CLIP-seq
MIRT1982585	hsa-miR-4699-3p	CLIP-seq
MIRT2217485	hsa-miR-4708-5p	CLIP-seq
MIRT2217486	hsa-miR-4728-5p	CLIP-seq
MIRT2217487	hsa-miR-4739	CLIP-seq
MIRT2217488	hsa-miR-4742-5p	CLIP-seq
MIRT2217489	hsa-miR-4756-5p	CLIP-seq
MIRT2217490	hsa-miR-4765	CLIP-seq
MIRT2217491	hsa-miR-4770	CLIP-seq
MIRT2217492	hsa-miR-4779	CLIP-seq
MIRT2217493	hsa-miR-4783-3p	CLIP-seq
MIRT2217494	hsa-miR-4793-3p	CLIP-seq
MIRT954255	hsa-miR-494	CLIP-seq
MIRT2217495	hsa-miR-497	CLIP-seq
MIRT2217496	hsa-miR-510	CLIP-seq
MIRT2217497	hsa-miR-515-3p	CLIP-seq
MIRT1982588	hsa-miR-518a-5p	CLIP-seq
MIRT2217498	hsa-miR-519e	CLIP-seq
MIRT2217499	hsa-miR-520d-5p	CLIP-seq
MIRT2217500	hsa-miR-520g	CLIP-seq
MIRT2217501	hsa-miR-520h	CLIP-seq
MIRT2217502	hsa-miR-524-5p	CLIP-seq
MIRT1982589	hsa-miR-527	CLIP-seq
MIRT2217503	hsa-miR-532-5p	CLIP-seq
MIRT2217504	hsa-miR-544	CLIP-seq
MIRT2217505	hsa-miR-545	CLIP-seq
MIRT2217506	hsa-miR-548p	CLIP-seq
MIRT954259	hsa-miR-576-3p	CLIP-seq
MIRT2217507	hsa-miR-578	CLIP-seq
MIRT2217508	hsa-miR-636	CLIP-seq
MIRT954262	hsa-miR-642a	CLIP-seq
MIRT2217509	hsa-miR-765	CLIP-seq
MIRT1982591	hsa-miR-892a	CLIP-seq
MIRT954233	hsa-miR-101	CLIP-seq
MIRT2521469	hsa-miR-1184	CLIP-seq
MIRT2217437	hsa-miR-1202	CLIP-seq
MIRT2521470	hsa-miR-1228	CLIP-seq
MIRT2521471	hsa-miR-127-5p	CLIP-seq
MIRT954236	hsa-miR-144	CLIP-seq
MIRT2521472	hsa-miR-151-3p	CLIP-seq
MIRT2217450	hsa-miR-19a	CLIP-seq
MIRT2217451	hsa-miR-19b	CLIP-seq
MIRT2521473	hsa-miR-300	CLIP-seq
MIRT2217455	hsa-miR-3065-3p	CLIP-seq
MIRT2217456	hsa-miR-3117-5p	CLIP-seq
MIRT2521474	hsa-miR-3121-3p	CLIP-seq
MIRT2521475	hsa-miR-3125	CLIP-seq
MIRT2217458	hsa-miR-3135b	CLIP-seq
MIRT2217459	hsa-miR-3137	CLIP-seq
MIRT2521476	hsa-miR-3173-3p	CLIP-seq
MIRT2521477	hsa-miR-3180-5p	CLIP-seq
MIRT2217461	hsa-miR-3194-5p	CLIP-seq
MIRT2521478	hsa-miR-329	CLIP-seq
MIRT2521479	hsa-miR-3619-3p	CLIP-seq
MIRT2521480	hsa-miR-362-3p	CLIP-seq
MIRT1982573	hsa-miR-3652	CLIP-seq
MIRT2521481	hsa-miR-3663-3p	CLIP-seq
MIRT2217465	hsa-miR-3687	CLIP-seq
MIRT2521482	hsa-miR-377	CLIP-seq
MIRT2521483	hsa-miR-381	CLIP-seq
MIRT2521484	hsa-miR-3910	CLIP-seq
MIRT2521485	hsa-miR-3916	CLIP-seq
MIRT2521486	hsa-miR-3940-3p	CLIP-seq
MIRT2521487	hsa-miR-3941	CLIP-seq
MIRT1982575	hsa-miR-3942-3p	CLIP-seq
MIRT2217469	hsa-miR-3972	CLIP-seq
MIRT2521488	hsa-miR-4271	CLIP-seq
MIRT2217475	hsa-miR-4423-5p	CLIP-seq
MIRT1982579	hsa-miR-4430	CLIP-seq
MIRT2217476	hsa-miR-4442	CLIP-seq
MIRT2521489	hsa-miR-4504	CLIP-seq
MIRT2217480	hsa-miR-4520b-3p	CLIP-seq
MIRT2521490	hsa-miR-4529-3p	CLIP-seq
MIRT2521491	hsa-miR-4533	CLIP-seq
MIRT2521492	hsa-miR-4535	CLIP-seq
MIRT2521493	hsa-miR-4645-3p	CLIP-seq
MIRT2521494	hsa-miR-4652-3p	CLIP-seq
MIRT2521495	hsa-miR-4652-5p	CLIP-seq
MIRT2521496	hsa-miR-4666-3p	CLIP-seq
MIRT2521497	hsa-miR-4677-3p	CLIP-seq
MIRT2521498	hsa-miR-4679	CLIP-seq
MIRT2521499	hsa-miR-4708-3p	CLIP-seq
MIRT2521500	hsa-miR-4725-3p	CLIP-seq
MIRT2521501	hsa-miR-4725-5p	CLIP-seq
MIRT2217486	hsa-miR-4728-5p	CLIP-seq
MIRT2521502	hsa-miR-4747-5p	CLIP-seq
MIRT2521503	hsa-miR-4759	CLIP-seq
MIRT2521504	hsa-miR-4776-5p	CLIP-seq
MIRT2217492	hsa-miR-4779	CLIP-seq
MIRT2521505	hsa-miR-4789-3p	CLIP-seq
MIRT2521506	hsa-miR-4789-5p	CLIP-seq
MIRT2521507	hsa-miR-485-3p	CLIP-seq
MIRT2521508	hsa-miR-487a	CLIP-seq
MIRT954255	hsa-miR-494	CLIP-seq
MIRT2521509	hsa-miR-504	CLIP-seq
MIRT1982587	hsa-miR-507	CLIP-seq
MIRT2521510	hsa-miR-508-5p	CLIP-seq
MIRT1982588	hsa-miR-518a-5p	CLIP-seq
MIRT2521511	hsa-miR-518d-5p	CLIP-seq
MIRT2521512	hsa-miR-519b-5p	CLIP-seq
MIRT2521513	hsa-miR-519c-5p	CLIP-seq
MIRT2521514	hsa-miR-520c-5p	CLIP-seq
MIRT2217500	hsa-miR-520g	CLIP-seq
MIRT2217501	hsa-miR-520h	CLIP-seq
MIRT2521515	hsa-miR-521	CLIP-seq
MIRT2521516	hsa-miR-526a	CLIP-seq
MIRT1982589	hsa-miR-527	CLIP-seq
MIRT2521517	hsa-miR-542-3p	CLIP-seq
MIRT1982590	hsa-miR-557	CLIP-seq
MIRT2521518	hsa-miR-603	CLIP-seq
MIRT2521519	hsa-miR-618	CLIP-seq
MIRT2521520	hsa-miR-642b	CLIP-seq
MIRT2217509	hsa-miR-765	CLIP-seq
MIRT2521521	hsa-miR-873	CLIP-seq
MIRT2521522	hsa-miR-877	CLIP-seq
MIRT2217450	hsa-miR-19a	CLIP-seq
MIRT2217451	hsa-miR-19b	CLIP-seq
MIRT2521493	hsa-miR-4645-3p	CLIP-seq
MIRT2521503	hsa-miR-4759	CLIP-seq
MIRT954255	hsa-miR-494	CLIP-seq
MIRT2521511	hsa-miR-518d-5p	CLIP-seq
MIRT2521512	hsa-miR-519b-5p	CLIP-seq
MIRT2521513	hsa-miR-519c-5p	CLIP-seq
MIRT2521514	hsa-miR-520c-5p	CLIP-seq
MIRT2521516	hsa-miR-526a	CLIP-seq
MIRT2521519	hsa-miR-618	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	12734395
GO:0001525	Process	Angiogenesis	IDA	12734395, 22555806
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IMP	28687708, 30578106
GO:0001618	Function	Virus receptor activity	IEA
GO:0001945	Process	Lymph vessel development	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IDA	12734395
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	12606549, 15764601, 18488039, 19836338, 26481148, 28514442, 28904190, 32296183, 33961781, 35384245
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28931592
GO:0005886	Component	Plasma membrane	IDA	17251577
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IDA	12734395
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	26268439
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9630219
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0010839	Process	Negative regulation of keratinocyte proliferation	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IDA	10066262
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	12734395, 16867992, 22555806
GO:0030425	Component	Dendrite	IEA
GO:0031295	Process	T cell costimulation	IEA
GO:0034332	Process	Adherens junction organization	IEA
GO:0042734	Component	Presynaptic membrane	IBA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046875	Function	Ephrin receptor binding	IBA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	12734395
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IMP	22555806
GO:0048018	Function	Receptor ligand activity	IDA	12734395, 16867992, 22555806
GO:0048514	Process	Blood vessel morphogenesis	IBA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048845	Process	Venous blood vessel morphogenesis	IEA
GO:0050920	Process	Regulation of chemotaxis	IDA	12734395
GO:0070161	Component	Anchoring junction	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0072178	Process	Nephric duct morphogenesis	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099054	Process	Presynapse assembly	IEA
GO:0099072	Process	Regulation of postsynaptic membrane neurotransmitter receptor levels	IEA
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IEA
GO:1903849	Process	Positive regulation of aorta morphogenesis	IEA
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	IEA
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	ISS	17336907

Other IDs

• MIM: 600527
• HGNC: 3227
• e!Ensembl: ENSG00000125266

Protein

• UniProt ID: P52799
• Protein name: Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L)
• Protein function: Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing o
• PDB: 2HLE, 2I85, 2VSK, 2VSM, 2WO2, 3GXU, 4UF7, 6P7Y, 6PDL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00812	Ephrin	29 → 164	Ephrin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Lung and kidney.
• Sequence:

  MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
  ICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPN
  LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPT
  RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
  IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
  CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

• Sequence length: 333

Pathways

KEGG:

Axon guidance

Reactome:

EPH-Ephrin signaling
EPHB-mediated forward signaling
Ephrin signaling
EPH-ephrin mediated repulsion of cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONGENITAL ABSENCE OF LUNG	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EFNB2-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30106131		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	27649287		★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	BEFREE	20105145		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30662604		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25779027		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28599074	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	19728339		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21672356	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28320388		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19664212	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15067119, 20668305, 31638179		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23981902, 31638179	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24771266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27013613		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25645722	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28320388		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26345967, 32036221	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33761933	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28393221		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28393221, 30423812	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29736174		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25012246	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30205087		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	18580054, 31092297		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11920461, 15083195		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11920461	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15083195		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15083195, 26494468		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32036221, 32751332	Associate	★☆☆☆☆ Found in Text Mining only
Congenital absence of lung	Congenital lung agenesis	CTD_human_DG	30106123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	29897969		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	30106123		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15996027		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	15996027		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	15996027	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19035475		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	19035475		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30620753		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30620753		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18580054		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	16360397		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29738359		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	28454369		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17108150	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	40045230	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17611172		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24771266	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	26414866		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19728339		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19728339	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19728339		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12271360, 19728339		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19728339	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	28393221	Associate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	30423812	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27530629		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	17380111		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	20105145		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15996027	Stimulate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29508392		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	24517927, 32286515	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30722785		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	15471957		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	15471957, 18836096		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18580054		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18580054	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	18580054, 31092297		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24922654		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10221518, 16951162, 30205087		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10221518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27935865		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	15067119, 20668305, 31638179		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27935865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26345967		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30214580		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16360397		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28320388		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17611172, 29848571, 30214580, 30776480		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15083195		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25258252	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10389937, 10984508, 15067119, 15083195, 16360397, 16951162, 17611172, 22020958, 23887168, 26044849, 26494468, 27649287, 27941840, 28186980, 29190834, 30205087, 30214580, 30776480, 30894369, 31065284		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10389937, 10984508, 17947461		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21109931	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	29508392		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39213112	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39213112	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	12209731	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18231102	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26345967		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30662604		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26345967, 33648511	Associate	★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	27013613		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	27013613		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	28599054		★☆☆☆☆ Found in Text Mining only
Primary pulmonary hypoplasia	Pulmonary Hypoplasia	CTD_human_DG	30106123		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31574534		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28035996	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29058717		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	19764912		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25779027		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	15471957	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20483485, 27028544, 27650867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20483485		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Simple Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	28454369		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	31065284		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17611172		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27649287, 29190834		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17611172, 24771266		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32036221, 36438491	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27649287, 27941840, 29848571, 29970482, 30894369		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30214580		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12136247		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12136247	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27986811	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16360397		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	27649287		★☆☆☆☆ Found in Text Mining only
Unilateral lobar pulmonary agenesis	Unilateral Lobar Pulmonary Agenesis	CTD_human_DG	30106123		★☆☆☆☆ Found in Text Mining only
Unilateral lung agenesis	Lung agenesis	CTD_human_DG	30106123		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28320388	Associate	★☆☆☆☆ Found in Text Mining only
Urogenital Abnormalities	Urogenital abnormalities	Pubtator	28393221	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	26808710	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	28910333	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	19696168	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	22010211		★☆☆☆☆ Found in Text Mining only