Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1945
Gene name	Ephrin A4
Gene symbol	EFNA4
Synonyms (NCBI Gene)	EFL4EPLG4LERK-4LERK4
Chromosome	1
Chromosome location	1q21.3
Summary	This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029402	hsa-miR-26b-5p	Microarray	19088304
MIRT2217410	hsa-miR-1207-3p	CLIP-seq
MIRT2217411	hsa-miR-361-3p	CLIP-seq
MIRT2521290	hsa-miR-146b-3p	CLIP-seq
MIRT2521291	hsa-miR-18a	CLIP-seq
MIRT2521292	hsa-miR-18b	CLIP-seq
MIRT2521293	hsa-miR-1913	CLIP-seq
MIRT2521294	hsa-miR-1915	CLIP-seq
MIRT2521295	hsa-miR-2278	CLIP-seq
MIRT2521296	hsa-miR-3150a-3p	CLIP-seq
MIRT2521297	hsa-miR-3152-5p	CLIP-seq
MIRT2521298	hsa-miR-3157-3p	CLIP-seq
MIRT2521299	hsa-miR-3173-5p	CLIP-seq
MIRT2521300	hsa-miR-3175	CLIP-seq
MIRT2521301	hsa-miR-3189-5p	CLIP-seq
MIRT2521302	hsa-miR-324-3p	CLIP-seq
MIRT2521303	hsa-miR-331-3p	CLIP-seq
MIRT2521304	hsa-miR-338-3p	CLIP-seq
MIRT2521305	hsa-miR-3616-3p	CLIP-seq
MIRT2521306	hsa-miR-3977	CLIP-seq
MIRT2521307	hsa-miR-4292	CLIP-seq
MIRT2521308	hsa-miR-431	CLIP-seq
MIRT2521309	hsa-miR-4530	CLIP-seq
MIRT2521310	hsa-miR-4659a-3p	CLIP-seq
MIRT2521311	hsa-miR-4659b-3p	CLIP-seq
MIRT2521312	hsa-miR-4667-5p	CLIP-seq
MIRT2521313	hsa-miR-4668-5p	CLIP-seq
MIRT2521314	hsa-miR-4700-5p	CLIP-seq
MIRT2521315	hsa-miR-4728-5p	CLIP-seq
MIRT2521316	hsa-miR-4735-3p	CLIP-seq
MIRT2521317	hsa-miR-4758-3p	CLIP-seq
MIRT2521318	hsa-miR-4761-5p	CLIP-seq
MIRT2521319	hsa-miR-4778-3p	CLIP-seq
MIRT2521320	hsa-miR-4786-5p	CLIP-seq
MIRT2521321	hsa-miR-511	CLIP-seq
MIRT2521322	hsa-miR-518a-3p	CLIP-seq
MIRT2521323	hsa-miR-518a-5p	CLIP-seq
MIRT2521324	hsa-miR-518b	CLIP-seq
MIRT2521325	hsa-miR-518c	CLIP-seq
MIRT2521326	hsa-miR-518d-3p	CLIP-seq
MIRT2521327	hsa-miR-518f	CLIP-seq
MIRT2521328	hsa-miR-527	CLIP-seq
MIRT2521329	hsa-miR-596	CLIP-seq
MIRT2521330	hsa-miR-759	CLIP-seq
MIRT2521331	hsa-miR-769-5p	CLIP-seq
MIRT2521332	hsa-miR-874	CLIP-seq
MIRT2521333	hsa-miR-939	CLIP-seq
MIRT2521291	hsa-miR-18a	CLIP-seq
MIRT2521292	hsa-miR-18b	CLIP-seq
MIRT2521293	hsa-miR-1913	CLIP-seq
MIRT2521294	hsa-miR-1915	CLIP-seq
MIRT2521295	hsa-miR-2278	CLIP-seq
MIRT2521296	hsa-miR-3150a-3p	CLIP-seq
MIRT2521300	hsa-miR-3175	CLIP-seq
MIRT2521301	hsa-miR-3189-5p	CLIP-seq
MIRT2521302	hsa-miR-324-3p	CLIP-seq
MIRT2521303	hsa-miR-331-3p	CLIP-seq
MIRT2521305	hsa-miR-3616-3p	CLIP-seq
MIRT2521307	hsa-miR-4292	CLIP-seq
MIRT2521312	hsa-miR-4667-5p	CLIP-seq
MIRT2521313	hsa-miR-4668-5p	CLIP-seq
MIRT2521314	hsa-miR-4700-5p	CLIP-seq
MIRT2521315	hsa-miR-4728-5p	CLIP-seq
MIRT2521316	hsa-miR-4735-3p	CLIP-seq
MIRT2521317	hsa-miR-4758-3p	CLIP-seq
MIRT2521318	hsa-miR-4761-5p	CLIP-seq
MIRT2521320	hsa-miR-4786-5p	CLIP-seq
MIRT2521322	hsa-miR-518a-3p	CLIP-seq
MIRT2521323	hsa-miR-518a-5p	CLIP-seq
MIRT2521324	hsa-miR-518b	CLIP-seq
MIRT2521325	hsa-miR-518c	CLIP-seq
MIRT2521326	hsa-miR-518d-3p	CLIP-seq
MIRT2521327	hsa-miR-518f	CLIP-seq
MIRT2521328	hsa-miR-527	CLIP-seq
MIRT2521329	hsa-miR-596	CLIP-seq
MIRT2521331	hsa-miR-769-5p	CLIP-seq
MIRT2521333	hsa-miR-939	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005005	Function	Transmembrane-ephrin receptor activity	TAS	8660976
GO:0005515	Function	Protein binding	IPI	15777695, 19836338, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8660976
GO:0007267	Process	Cell-cell signaling	TAS	8660976
GO:0007411	Process	Axon guidance	IBA
GO:0016020	Component	Membrane	IEA
GO:0046875	Function	Ephrin receptor binding	IBA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	11519828, 15777695
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
601380	3224	ENSG00000243364

P52798

Protein name

Ephrin-A4 (EPH-related receptor tyrosine kinase ligand 4) (LERK-4)

Protein function

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on ad

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00812	Ephrin	25 → 156	Ephrin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.

Sequence

MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDT
PSPLCLLLLLLLLILRLLRIL

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway PI3K-Akt signaling pathway Axon guidance MicroRNAs in cancer		EPH-Ephrin signaling EPHA-mediated growth cone collapse EPH-ephrin mediated repulsion of cells

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28851287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33977106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28669080, 36404439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18819711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniofrontonasal dysplasia	Craniofrontonasal Dysplasia	BEFREE	28135115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	29215649, 36140816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	16540516, 28135115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	20462350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20071790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25258252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30680712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	12209731, 20071790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35918384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30680712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	20462350		★★★★★ ★☆☆☆☆ Found in Text Mining only

EFNA4 (ephrin A4)