EFNA1 (ephrin A1)

Gene

• Entrez ID: 1942
• Gene name: Ephrin A1
• Gene symbol: EFNA1
• Synonyms (NCBI Gene): B61, ECKLG, EFL1, EPLG1, GMAN, LERK-1, LERK1, TNFAIP4
• Chromosome: 1
• Chromosome location: 1q22
• Summary: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001058	hsa-miR-218-5p	qRT-PCR, Western blot	17998940
MIRT016724	hsa-miR-335-5p	Microarray	18185580
MIRT021322	hsa-miR-9-5p	Microarray	17612493
MIRT022145	hsa-miR-124-3p	Microarray	18668037
MIRT053497	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR	23065816
MIRT477659	hsa-miR-548an	PAR-CLIP	23592263
MIRT477658	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT477657	hsa-miR-4484	PAR-CLIP	23592263
MIRT477656	hsa-miR-3714	PAR-CLIP	23592263
MIRT477655	hsa-miR-3169	PAR-CLIP	23592263
MIRT477654	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT477652	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT477653	hsa-miR-940	PAR-CLIP	23592263
MIRT477651	hsa-miR-4790-3p	PAR-CLIP	23592263
MIRT477650	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT477649	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT477648	hsa-miR-3153	PAR-CLIP	23592263
MIRT477647	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT477646	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT477645	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT477644	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT477643	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT477642	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT477640	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT477641	hsa-miR-619-3p	PAR-CLIP	23592263
MIRT477639	hsa-miR-7851-3p	PAR-CLIP	23592263
MIRT059816	hsa-miR-3123	PAR-CLIP	23592263
MIRT059819	hsa-miR-2392	PAR-CLIP	23592263
MIRT477638	hsa-miR-512-3p	PAR-CLIP	23592263
MIRT059824	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT477637	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT059814	hsa-miR-1283	PAR-CLIP	23592263
MIRT477636	hsa-miR-1913	PAR-CLIP	23592263
MIRT477635	hsa-miR-324-3p	PAR-CLIP	23592263
MIRT059821	hsa-miR-4794	PAR-CLIP	23592263
MIRT059815	hsa-miR-664a-5p	PAR-CLIP	23592263
MIRT477634	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT477633	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT477632	hsa-miR-8089	PAR-CLIP	23592263
MIRT477631	hsa-miR-637	PAR-CLIP	23592263
MIRT477630	hsa-miR-7155-5p	PAR-CLIP	23592263
MIRT477629	hsa-miR-5699-5p	PAR-CLIP	23592263
MIRT477628	hsa-miR-4758-3p	PAR-CLIP	23592263
MIRT477627	hsa-miR-3189-5p	PAR-CLIP	23592263
MIRT059809	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT477626	hsa-miR-6882-3p	PAR-CLIP	23592263
MIRT059811	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT059817	hsa-miR-4306	PAR-CLIP	23592263
MIRT059820	hsa-miR-4644	PAR-CLIP	23592263
MIRT477625	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT477624	hsa-miR-3175	PAR-CLIP	23592263
MIRT477623	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT477622	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT477621	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT059812	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT059808	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT059823	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT477620	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT477619	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT059814	hsa-miR-1283	PAR-CLIP	26701625
MIRT059814	hsa-miR-1283	PAR-CLIP	26701625
MIRT059814	hsa-miR-1283	PAR-CLIP	26701625
MIRT059811	hsa-miR-185-5p	PAR-CLIP	26701625
MIRT059811	hsa-miR-185-5p	PAR-CLIP	26701625
MIRT059811	hsa-miR-185-5p	PAR-CLIP	26701625
MIRT059809	hsa-miR-187-5p	PAR-CLIP	26701625
MIRT059809	hsa-miR-187-5p	PAR-CLIP	26701625
MIRT059809	hsa-miR-187-5p	PAR-CLIP	26701625
MIRT059819	hsa-miR-2392	PAR-CLIP	26701625
MIRT059819	hsa-miR-2392	PAR-CLIP	26701625
MIRT059819	hsa-miR-2392	PAR-CLIP	26701625
MIRT059812	hsa-miR-30c-1-3p	PAR-CLIP	26701625
MIRT059812	hsa-miR-30c-1-3p	PAR-CLIP	26701625
MIRT059812	hsa-miR-30c-1-3p	PAR-CLIP	26701625
MIRT059808	hsa-miR-30c-2-3p	PAR-CLIP	26701625
MIRT059808	hsa-miR-30c-2-3p	PAR-CLIP	26701625
MIRT059808	hsa-miR-30c-2-3p	PAR-CLIP	26701625
MIRT059816	hsa-miR-3123	PAR-CLIP	26701625
MIRT059816	hsa-miR-3123	PAR-CLIP	26701625
MIRT059816	hsa-miR-3123	PAR-CLIP	26701625
MIRT477627	hsa-miR-3189-5p	PAR-CLIP	26701625
MIRT477627	hsa-miR-3189-5p	PAR-CLIP	26701625
MIRT477627	hsa-miR-3189-5p	PAR-CLIP	26701625
MIRT059817	hsa-miR-4306	PAR-CLIP	26701625
MIRT059817	hsa-miR-4306	PAR-CLIP	26701625
MIRT059817	hsa-miR-4306	PAR-CLIP	26701625
MIRT059820	hsa-miR-4644	PAR-CLIP	26701625
MIRT059820	hsa-miR-4644	PAR-CLIP	26701625
MIRT059820	hsa-miR-4644	PAR-CLIP	26701625
MIRT477628	hsa-miR-4758-3p	PAR-CLIP	26701625
MIRT477628	hsa-miR-4758-3p	PAR-CLIP	26701625
MIRT477628	hsa-miR-4758-3p	PAR-CLIP	26701625
MIRT059821	hsa-miR-4794	PAR-CLIP	26701625
MIRT059821	hsa-miR-4794	PAR-CLIP	26701625
MIRT059821	hsa-miR-4794	PAR-CLIP	26701625
MIRT477629	hsa-miR-5699-5p	PAR-CLIP	26701625
MIRT477629	hsa-miR-5699-5p	PAR-CLIP	26701625
MIRT477629	hsa-miR-5699-5p	PAR-CLIP	26701625
MIRT477641	hsa-miR-619-3p	PAR-CLIP	26701625
MIRT477641	hsa-miR-619-3p	PAR-CLIP	26701625
MIRT477641	hsa-miR-619-3p	PAR-CLIP	26701625
MIRT059815	hsa-miR-664a-5p	PAR-CLIP	26701625
MIRT059815	hsa-miR-664a-5p	PAR-CLIP	26701625
MIRT059815	hsa-miR-664a-5p	PAR-CLIP	26701625
MIRT059823	hsa-miR-6788-5p	PAR-CLIP	26701625
MIRT059823	hsa-miR-6788-5p	PAR-CLIP	26701625
MIRT059823	hsa-miR-6788-5p	PAR-CLIP	26701625
MIRT477637	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT477637	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT477637	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT059824	hsa-miR-6871-5p	PAR-CLIP	26701625
MIRT059824	hsa-miR-6871-5p	PAR-CLIP	26701625
MIRT059824	hsa-miR-6871-5p	PAR-CLIP	26701625
MIRT477639	hsa-miR-7851-3p	PAR-CLIP	26701625
MIRT477639	hsa-miR-7851-3p	PAR-CLIP	26701625
MIRT477639	hsa-miR-7851-3p	PAR-CLIP	26701625
MIRT477659	hsa-miR-548an	PAR-CLIP	23592263
MIRT477658	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT477657	hsa-miR-4484	PAR-CLIP	23592263
MIRT477656	hsa-miR-3714	PAR-CLIP	23592263
MIRT477655	hsa-miR-3169	PAR-CLIP	23592263
MIRT477654	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT477652	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT477653	hsa-miR-940	PAR-CLIP	23592263
MIRT477651	hsa-miR-4790-3p	PAR-CLIP	23592263
MIRT477650	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT477649	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT477648	hsa-miR-3153	PAR-CLIP	23592263
MIRT477647	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT477646	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT477645	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT477644	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT477643	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT477642	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT477640	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT477641	hsa-miR-619-3p	PAR-CLIP	23592263
MIRT477639	hsa-miR-7851-3p	PAR-CLIP	23592263
MIRT059816	hsa-miR-3123	PAR-CLIP	23592263
MIRT059819	hsa-miR-2392	PAR-CLIP	23592263
MIRT477638	hsa-miR-512-3p	PAR-CLIP	23592263
MIRT059824	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT477637	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT059814	hsa-miR-1283	PAR-CLIP	23592263
MIRT477636	hsa-miR-1913	PAR-CLIP	23592263
MIRT477635	hsa-miR-324-3p	PAR-CLIP	23592263
MIRT059821	hsa-miR-4794	PAR-CLIP	23592263
MIRT059815	hsa-miR-664a-5p	PAR-CLIP	23592263
MIRT477634	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT477633	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT477632	hsa-miR-8089	PAR-CLIP	23592263
MIRT477631	hsa-miR-637	PAR-CLIP	23592263
MIRT477630	hsa-miR-7155-5p	PAR-CLIP	23592263
MIRT477629	hsa-miR-5699-5p	PAR-CLIP	23592263
MIRT477628	hsa-miR-4758-3p	PAR-CLIP	23592263
MIRT477627	hsa-miR-3189-5p	PAR-CLIP	23592263
MIRT059809	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT477626	hsa-miR-6882-3p	PAR-CLIP	23592263
MIRT059811	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT059817	hsa-miR-4306	PAR-CLIP	23592263
MIRT059820	hsa-miR-4644	PAR-CLIP	23592263
MIRT477625	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT477624	hsa-miR-3175	PAR-CLIP	23592263
MIRT477623	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT477622	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT477621	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT059812	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT059808	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT059823	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT477620	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT477619	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT953918	hsa-miR-1304	CLIP-seq
MIRT953919	hsa-miR-140-5p	CLIP-seq
MIRT953920	hsa-miR-185	CLIP-seq
MIRT953921	hsa-miR-1915	CLIP-seq
MIRT953922	hsa-miR-2052	CLIP-seq
MIRT953923	hsa-miR-21	CLIP-seq
MIRT953924	hsa-miR-2467-5p	CLIP-seq
MIRT953925	hsa-miR-2682	CLIP-seq
MIRT953926	hsa-miR-3120-3p	CLIP-seq
MIRT953927	hsa-miR-3188	CLIP-seq
MIRT953928	hsa-miR-326	CLIP-seq
MIRT953929	hsa-miR-330-5p	CLIP-seq
MIRT953930	hsa-miR-3975	CLIP-seq
MIRT953931	hsa-miR-4436a	CLIP-seq
MIRT953932	hsa-miR-449c	CLIP-seq
MIRT953933	hsa-miR-4633-5p	CLIP-seq
MIRT953934	hsa-miR-4643	CLIP-seq
MIRT953935	hsa-miR-466	CLIP-seq
MIRT953936	hsa-miR-4717-3p	CLIP-seq
MIRT953937	hsa-miR-4726-3p	CLIP-seq
MIRT953938	hsa-miR-4789-3p	CLIP-seq
MIRT953939	hsa-miR-485-5p	CLIP-seq
MIRT953940	hsa-miR-532-5p	CLIP-seq
MIRT953941	hsa-miR-541	CLIP-seq
MIRT953942	hsa-miR-590-5p	CLIP-seq
MIRT953943	hsa-miR-600	CLIP-seq
MIRT953944	hsa-miR-619	CLIP-seq
MIRT953945	hsa-miR-645	CLIP-seq
MIRT953946	hsa-miR-891b	CLIP-seq
MIRT953947	hsa-miR-938	CLIP-seq
MIRT953948	hsa-miR-939	CLIP-seq
MIRT953949	hsa-miR-1245b-3p	CLIP-seq
MIRT953950	hsa-miR-1271	CLIP-seq
MIRT953951	hsa-miR-1284	CLIP-seq
MIRT953952	hsa-miR-1291	CLIP-seq
MIRT953953	hsa-miR-200b	CLIP-seq
MIRT953954	hsa-miR-200c	CLIP-seq
MIRT953955	hsa-miR-2115	CLIP-seq
MIRT953925	hsa-miR-2682	CLIP-seq
MIRT953956	hsa-miR-296-5p	CLIP-seq
MIRT953926	hsa-miR-3120-3p	CLIP-seq
MIRT953957	hsa-miR-3156-3p	CLIP-seq
MIRT953958	hsa-miR-3173-5p	CLIP-seq
MIRT953959	hsa-miR-3192	CLIP-seq
MIRT953960	hsa-miR-3667-3p	CLIP-seq
MIRT953961	hsa-miR-3688-5p	CLIP-seq
MIRT953962	hsa-miR-370	CLIP-seq
MIRT953963	hsa-miR-374c	CLIP-seq
MIRT953964	hsa-miR-3943	CLIP-seq
MIRT953965	hsa-miR-3944-3p	CLIP-seq
MIRT953966	hsa-miR-4267	CLIP-seq
MIRT953967	hsa-miR-429	CLIP-seq
MIRT953968	hsa-miR-4301	CLIP-seq
MIRT953969	hsa-miR-431	CLIP-seq
MIRT953970	hsa-miR-4492	CLIP-seq
MIRT953971	hsa-miR-4498	CLIP-seq
MIRT953932	hsa-miR-449c	CLIP-seq
MIRT953972	hsa-miR-4511	CLIP-seq
MIRT953973	hsa-miR-451b	CLIP-seq
MIRT953974	hsa-miR-452	CLIP-seq
MIRT953975	hsa-miR-4660	CLIP-seq
MIRT953976	hsa-miR-4664-3p	CLIP-seq
MIRT953977	hsa-miR-4676-3p	CLIP-seq
MIRT953978	hsa-miR-4708-5p	CLIP-seq
MIRT953979	hsa-miR-4731-5p	CLIP-seq
MIRT953980	hsa-miR-4738-3p	CLIP-seq
MIRT953981	hsa-miR-4757-5p	CLIP-seq
MIRT953982	hsa-miR-4773	CLIP-seq
MIRT953983	hsa-miR-4789-5p	CLIP-seq
MIRT953984	hsa-miR-532-3p	CLIP-seq
MIRT953985	hsa-miR-548b-3p	CLIP-seq
MIRT953986	hsa-miR-548g	CLIP-seq
MIRT953987	hsa-miR-550a	CLIP-seq
MIRT953988	hsa-miR-570	CLIP-seq
MIRT953989	hsa-miR-578	CLIP-seq
MIRT953944	hsa-miR-619	CLIP-seq
MIRT953945	hsa-miR-645	CLIP-seq
MIRT953990	hsa-miR-655	CLIP-seq
MIRT953991	hsa-miR-671-3p	CLIP-seq
MIRT953992	hsa-miR-762	CLIP-seq
MIRT953993	hsa-miR-885-3p	CLIP-seq
MIRT953946	hsa-miR-891b	CLIP-seq
MIRT953947	hsa-miR-938	CLIP-seq
MIRT953994	hsa-miR-942	CLIP-seq
MIRT953995	hsa-miR-96	CLIP-seq
MIRT953951	hsa-miR-1284	CLIP-seq
MIRT1982463	hsa-miR-1285	CLIP-seq
MIRT953919	hsa-miR-140-5p	CLIP-seq
MIRT1982464	hsa-miR-145	CLIP-seq
MIRT953921	hsa-miR-1915	CLIP-seq
MIRT1982465	hsa-miR-205	CLIP-seq
MIRT953923	hsa-miR-21	CLIP-seq
MIRT1982466	hsa-miR-223	CLIP-seq
MIRT953926	hsa-miR-3120-3p	CLIP-seq
MIRT1982467	hsa-miR-3187-5p	CLIP-seq
MIRT953959	hsa-miR-3192	CLIP-seq
MIRT953928	hsa-miR-326	CLIP-seq
MIRT953929	hsa-miR-330-5p	CLIP-seq
MIRT953960	hsa-miR-3667-3p	CLIP-seq
MIRT1982468	hsa-miR-3674	CLIP-seq
MIRT953962	hsa-miR-370	CLIP-seq
MIRT1982469	hsa-miR-378g	CLIP-seq
MIRT1982470	hsa-miR-3925-3p	CLIP-seq
MIRT953964	hsa-miR-3943	CLIP-seq
MIRT1982471	hsa-miR-3945	CLIP-seq
MIRT1982472	hsa-miR-4253	CLIP-seq
MIRT1982473	hsa-miR-4277	CLIP-seq
MIRT1982474	hsa-miR-4283	CLIP-seq
MIRT953969	hsa-miR-431	CLIP-seq
MIRT953931	hsa-miR-4436a	CLIP-seq
MIRT1982475	hsa-miR-4446-3p	CLIP-seq
MIRT1982476	hsa-miR-4486	CLIP-seq
MIRT1982477	hsa-miR-4488	CLIP-seq
MIRT953970	hsa-miR-4492	CLIP-seq
MIRT953971	hsa-miR-4498	CLIP-seq
MIRT1982478	hsa-miR-4505	CLIP-seq
MIRT953933	hsa-miR-4633-5p	CLIP-seq
MIRT953976	hsa-miR-4664-3p	CLIP-seq
MIRT1982479	hsa-miR-4685-5p	CLIP-seq
MIRT1982480	hsa-miR-4697-5p	CLIP-seq
MIRT1982481	hsa-miR-4704-3p	CLIP-seq
MIRT953978	hsa-miR-4708-5p	CLIP-seq
MIRT953937	hsa-miR-4726-3p	CLIP-seq
MIRT953979	hsa-miR-4731-5p	CLIP-seq
MIRT953981	hsa-miR-4757-5p	CLIP-seq
MIRT1982482	hsa-miR-4766-5p	CLIP-seq
MIRT953983	hsa-miR-4789-5p	CLIP-seq
MIRT1982483	hsa-miR-4796-3p	CLIP-seq
MIRT1982484	hsa-miR-508-5p	CLIP-seq
MIRT953940	hsa-miR-532-5p	CLIP-seq
MIRT953941	hsa-miR-541	CLIP-seq
MIRT1982485	hsa-miR-548ae	CLIP-seq
MIRT1982486	hsa-miR-548aj	CLIP-seq
MIRT1982487	hsa-miR-548am	CLIP-seq
MIRT1982488	hsa-miR-548x	CLIP-seq
MIRT953942	hsa-miR-590-5p	CLIP-seq
MIRT1982489	hsa-miR-612	CLIP-seq
MIRT1982490	hsa-miR-663b	CLIP-seq
MIRT953991	hsa-miR-671-3p	CLIP-seq
MIRT1982491	hsa-miR-760	CLIP-seq
MIRT953992	hsa-miR-762	CLIP-seq
MIRT953946	hsa-miR-891b	CLIP-seq
MIRT953947	hsa-miR-938	CLIP-seq
MIRT953948	hsa-miR-939	CLIP-seq
MIRT953949	hsa-miR-1245b-3p	CLIP-seq
MIRT953951	hsa-miR-1284	CLIP-seq
MIRT1982463	hsa-miR-1285	CLIP-seq
MIRT953952	hsa-miR-1291	CLIP-seq
MIRT2217355	hsa-miR-183	CLIP-seq
MIRT2217356	hsa-miR-1976	CLIP-seq
MIRT1982465	hsa-miR-205	CLIP-seq
MIRT1982466	hsa-miR-223	CLIP-seq
MIRT953925	hsa-miR-2682	CLIP-seq
MIRT953956	hsa-miR-296-5p	CLIP-seq
MIRT953958	hsa-miR-3173-5p	CLIP-seq
MIRT1982467	hsa-miR-3187-5p	CLIP-seq
MIRT953959	hsa-miR-3192	CLIP-seq
MIRT953960	hsa-miR-3667-3p	CLIP-seq
MIRT953961	hsa-miR-3688-5p	CLIP-seq
MIRT2217357	hsa-miR-3690	CLIP-seq
MIRT1982469	hsa-miR-378g	CLIP-seq
MIRT2217358	hsa-miR-3934	CLIP-seq
MIRT953965	hsa-miR-3944-3p	CLIP-seq
MIRT1982471	hsa-miR-3945	CLIP-seq
MIRT1982472	hsa-miR-4253	CLIP-seq
MIRT2217359	hsa-miR-4254	CLIP-seq
MIRT1982473	hsa-miR-4277	CLIP-seq
MIRT953969	hsa-miR-431	CLIP-seq
MIRT1982476	hsa-miR-4486	CLIP-seq
MIRT953970	hsa-miR-4492	CLIP-seq
MIRT953971	hsa-miR-4498	CLIP-seq
MIRT953932	hsa-miR-449c	CLIP-seq
MIRT953934	hsa-miR-4643	CLIP-seq
MIRT953935	hsa-miR-466	CLIP-seq
MIRT953975	hsa-miR-4660	CLIP-seq
MIRT953976	hsa-miR-4664-3p	CLIP-seq
MIRT1982481	hsa-miR-4704-3p	CLIP-seq
MIRT953936	hsa-miR-4717-3p	CLIP-seq
MIRT953979	hsa-miR-4731-5p	CLIP-seq
MIRT2217360	hsa-miR-4753-5p	CLIP-seq
MIRT953981	hsa-miR-4757-5p	CLIP-seq
MIRT953938	hsa-miR-4789-3p	CLIP-seq
MIRT953983	hsa-miR-4789-5p	CLIP-seq
MIRT1982489	hsa-miR-612	CLIP-seq
MIRT2217361	hsa-miR-644	CLIP-seq
MIRT953945	hsa-miR-645	CLIP-seq
MIRT953991	hsa-miR-671-3p	CLIP-seq
MIRT1982491	hsa-miR-760	CLIP-seq
MIRT953992	hsa-miR-762	CLIP-seq
MIRT953993	hsa-miR-885-3p	CLIP-seq
MIRT953947	hsa-miR-938	CLIP-seq
MIRT953994	hsa-miR-942	CLIP-seq
MIRT953947	hsa-miR-938	CLIP-seq
MIRT953951	hsa-miR-1284	CLIP-seq
MIRT953926	hsa-miR-3120-3p	CLIP-seq
MIRT953983	hsa-miR-4789-5p	CLIP-seq
MIRT953946	hsa-miR-891b	CLIP-seq
MIRT2521268	hsa-miR-1204	CLIP-seq
MIRT2521269	hsa-miR-3127-3p	CLIP-seq
MIRT953966	hsa-miR-4267	CLIP-seq
MIRT1982490	hsa-miR-663b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0001525	Process	Angiogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003183	Process	Mitral valve morphogenesis	IEA
GO:0003183	Process	Mitral valve morphogenesis	ISS
GO:0003199	Process	Endocardial cushion to mesenchymal transition involved in heart valve formation	IEA
GO:0003199	Process	Endocardial cushion to mesenchymal transition involved in heart valve formation	ISS
GO:0005102	Function	Signaling receptor binding	TAS	8660976
GO:0005515	Function	Protein binding	IPI	19525919, 19573808, 20505120, 22244754
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	24217950
GO:0005886	Component	Plasma membrane	TAS
GO:0007267	Process	Cell-cell signaling	TAS	8660976
GO:0007411	Process	Axon guidance	IBA
GO:0010605	Process	Negative regulation of macromolecule metabolic process	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	ISS
GO:0014028	Process	Notochord formation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IDA	10655584
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IDA	10655584
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IDA	10655584
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043535	Process	Regulation of blood vessel endothelial cell migration	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0046875	Function	Ephrin receptor binding	IBA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	11519828, 15777695
GO:0046875	Function	Ephrin receptor binding	TAS	2233719
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	10655584
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IGI	24217950
GO:0050730	Process	Regulation of peptidyl-tyrosine phosphorylation	ISS
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	10655584
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0050821	Process	Protein stabilization	IGI	24217950
GO:0061002	Process	Negative regulation of dendritic spine morphogenesis	IEA
GO:0061002	Process	Negative regulation of dendritic spine morphogenesis	ISS
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070244	Process	Negative regulation of thymocyte apoptotic process	IEA
GO:0098552	Component	Side of membrane	IEA
GO:1902004	Process	Positive regulation of amyloid-beta formation	IDA	24217950
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	IGI	24217950
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IGI	24217950
GO:1903051	Process	Negative regulation of proteolysis involved in protein catabolic process	IGI	24217950

Other IDs

• MIM: 191164
• HGNC: 3221
• e!Ensembl: ENSG00000169242

Protein

• UniProt ID: P20827
• Protein name: Ephrin-A1 (EPH-related receptor tyrosine kinase ligand 1) (LERK-1) (Immediate early response protein B61) (Tumor necrosis factor alpha-induced protein 4) (TNF alpha-induced protein 4) [Cleaved into: Ephrin-A1, secreted form]
• Protein function: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on ad
• PDB: 3CZU, 3HEI, 3MBW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00812	Ephrin	18 → 147	Ephrin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level). {ECO:0000269|PubMed:17332925}.
• Sequence:

  MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
  DAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
  KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG
  HSAAPRLFPLAWTVLLLPLLLLQTP

• Sequence length: 205

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
MicroRNAs in cancer

Reactome:

EPH-Ephrin signaling
EPHA-mediated growth cone collapse
EPH-ephrin mediated repulsion of cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BLADDER EXSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	22236865		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22807579		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	14707054		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16428472, 29367676		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16098464, 20154726, 21935409		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20154726		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15649254	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18794797, 21935409, 22261062, 26861043, 33977106	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	22236865		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15888795	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16428472, 29367676		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24293999		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25025847	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17158642, 18566674, 24040255	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34087884	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16061279, 28739735		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31077198	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37055577	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11741747		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21479221	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23258614, 24175772, 28560458, 30880748		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24175772, 34700376	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24175772, 36308379, 36401637, 40004552	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	17576607		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27143607		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25025847		★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	33522290	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26167956		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26167956		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32758187	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	28985758		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16061279		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34087884, 34399788	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16080548, 31485619	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37774793	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16254188, 18794797, 22688511	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	16254188, 34087884	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17332925, 19573808		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19573808	Inhibit	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24330498, 34344926	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36901860	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24040255	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26030479		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	18246128		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	36142557	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20061560	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15888795, 19642143, 20043122, 24969670, 28789425		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15888795		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24293999	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34399788	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16098464, 20154726, 21935409		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20154726		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24293999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28739735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23065816		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16428472, 29367676		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11741747, 20154726, 24175772, 30657619, 31485619		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20154726		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20154726		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20154726		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25258252	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10502726		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11891198	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24293999	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	15779235	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11146556, 15888795, 16061279, 16325507, 17041885, 20154726, 22236865, 22824143, 23686306, 24040255, 24215488, 24293999, 25025847, 26833123, 27533087, 28789425, 29367676, 30657619		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22824143, 24215488, 24293999, 27533087		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	33522290	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	12209731	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21166698		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28739735		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19573808	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22075945	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26030479		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24040255		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26450615		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23065816		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15649254		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15649254	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37579183	Stimulate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	16428472		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18566674	Associate	★☆☆☆☆ Found in Text Mining only