S1PR1 (sphingosine-1-phosphate receptor 1)

Gene

• Entrez ID: 1901
• Gene name: Sphingosine-1-phosphate receptor 1
• Gene symbol: S1PR1
• Synonyms (NCBI Gene): CD363, CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, S1P1
• Chromosome: 1
• Chromosome location: 1p21.2
• Summary: The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438751	hsa-miR-148a-3p	Hep3B	24798342
MIRT396670	hsa-miR-363-3p	Luciferase reporter assay, qRT-PCR, Western blot	24631531
MIRT396655	hsa-miR-125b-1-3p	Luciferase reporter assay, Western blot, qRT-PCR	25251470
MIRT396655	hsa-miR-125b-1-3p	Luciferase reporter assay, Western blot, qRT-PCR	25251470
MIRT438751	hsa-miR-148a-3p	Hep3B	24798342
MIRT396670	hsa-miR-363-3p	Luciferase reporter assay, qRT-PCR, Western blot	24631531
MIRT396655	hsa-miR-125b-1-3p	Luciferase reporter assay, Western blot, qRT-PCR	25251470
MIRT396655	hsa-miR-125b-1-3p	Luciferase reporter assay, Western blot, qRT-PCR	25251470
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT654062	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT654061	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT654060	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT654059	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT654058	hsa-miR-5193	HITS-CLIP	23824327
MIRT654057	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT654056	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT654055	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT654054	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT654053	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT654052	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT654051	hsa-miR-7977	HITS-CLIP	23824327
MIRT654050	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT654049	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT654047	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT654048	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT128036	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT128036	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT438751	hsa-miR-148a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25574238
MIRT438751	hsa-miR-148a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25574238
MIRT438751	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26004261
MIRT438751	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26004261
MIRT734561	hsa-miR-223-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	33574820
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT712216	hsa-miR-3177-3p	HITS-CLIP	19536157
MIRT712215	hsa-miR-4252	HITS-CLIP	19536157
MIRT712214	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT654062	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT654061	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT654060	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT654059	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT654058	hsa-miR-5193	HITS-CLIP	23824327
MIRT654057	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT654056	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT654055	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT654054	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT654053	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT654052	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT654051	hsa-miR-7977	HITS-CLIP	23824327
MIRT654050	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT654049	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT654047	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT654048	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT756272	hsa-miR-130a-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence, Flow cytometry, ELISA, RNA pull down assay	36582210
MIRT1324329	hsa-miR-4307	CLIP-seq
MIRT1553212	hsa-miR-330-3p	CLIP-seq
MIRT2393999	hsa-miR-186	CLIP-seq
MIRT2394000	hsa-miR-3133	CLIP-seq
MIRT2616415	hsa-miR-106a	CLIP-seq
MIRT2616416	hsa-miR-106b	CLIP-seq
MIRT2616417	hsa-miR-1231	CLIP-seq
MIRT2616418	hsa-miR-1260	CLIP-seq
MIRT2616419	hsa-miR-1260b	CLIP-seq
MIRT2616420	hsa-miR-1273e	CLIP-seq
MIRT2616421	hsa-miR-127-3p	CLIP-seq
MIRT2616422	hsa-miR-1279	CLIP-seq
MIRT2616423	hsa-miR-1293	CLIP-seq
MIRT2616424	hsa-miR-130a	CLIP-seq
MIRT2616425	hsa-miR-130b	CLIP-seq
MIRT2616426	hsa-miR-148a	CLIP-seq
MIRT2616427	hsa-miR-148b	CLIP-seq
MIRT2616428	hsa-miR-151-3p	CLIP-seq
MIRT2616429	hsa-miR-152	CLIP-seq
MIRT2616430	hsa-miR-155	CLIP-seq
MIRT2616431	hsa-miR-17	CLIP-seq
MIRT2616432	hsa-miR-181a	CLIP-seq
MIRT2616433	hsa-miR-181b	CLIP-seq
MIRT2616434	hsa-miR-181c	CLIP-seq
MIRT2616435	hsa-miR-181d	CLIP-seq
MIRT2616436	hsa-miR-188-3p	CLIP-seq
MIRT2616437	hsa-miR-19a	CLIP-seq
MIRT2616438	hsa-miR-19b	CLIP-seq
MIRT2616439	hsa-miR-2052	CLIP-seq
MIRT2616440	hsa-miR-20a	CLIP-seq
MIRT2616441	hsa-miR-20b	CLIP-seq
MIRT2616442	hsa-miR-24	CLIP-seq
MIRT2616443	hsa-miR-301a	CLIP-seq
MIRT2616444	hsa-miR-301b	CLIP-seq
MIRT2616445	hsa-miR-3065-5p	CLIP-seq
MIRT2616446	hsa-miR-3132	CLIP-seq
MIRT2616447	hsa-miR-3140-3p	CLIP-seq
MIRT2616448	hsa-miR-3146	CLIP-seq
MIRT2616449	hsa-miR-3156-3p	CLIP-seq
MIRT2616450	hsa-miR-3162-3p	CLIP-seq
MIRT1553212	hsa-miR-330-3p	CLIP-seq
MIRT2616451	hsa-miR-3613-3p	CLIP-seq
MIRT2616452	hsa-miR-3653	CLIP-seq
MIRT2616453	hsa-miR-3658	CLIP-seq
MIRT2616454	hsa-miR-3666	CLIP-seq
MIRT2616455	hsa-miR-3684	CLIP-seq
MIRT2616456	hsa-miR-3688-3p	CLIP-seq
MIRT2616457	hsa-miR-377	CLIP-seq
MIRT2616458	hsa-miR-4261	CLIP-seq
MIRT2616459	hsa-miR-4262	CLIP-seq
MIRT2616460	hsa-miR-4279	CLIP-seq
MIRT2616461	hsa-miR-4284	CLIP-seq
MIRT2616462	hsa-miR-4287	CLIP-seq
MIRT2616463	hsa-miR-4288	CLIP-seq
MIRT2616464	hsa-miR-4295	CLIP-seq
MIRT2616465	hsa-miR-4469	CLIP-seq
MIRT2616466	hsa-miR-4477b	CLIP-seq
MIRT2616467	hsa-miR-4483	CLIP-seq
MIRT2616468	hsa-miR-450b-5p	CLIP-seq
MIRT2616469	hsa-miR-454	CLIP-seq
MIRT2616470	hsa-miR-4639-5p	CLIP-seq
MIRT2616471	hsa-miR-4643	CLIP-seq
MIRT2616472	hsa-miR-4645-5p	CLIP-seq
MIRT2616473	hsa-miR-4650-3p	CLIP-seq
MIRT2616474	hsa-miR-466	CLIP-seq
MIRT2616475	hsa-miR-4666-5p	CLIP-seq
MIRT2616476	hsa-miR-4673	CLIP-seq
MIRT2616477	hsa-miR-4685-3p	CLIP-seq
MIRT2616478	hsa-miR-4685-5p	CLIP-seq
MIRT2616479	hsa-miR-4694-5p	CLIP-seq
MIRT2616480	hsa-miR-4757-5p	CLIP-seq
MIRT2616481	hsa-miR-4766-5p	CLIP-seq
MIRT2616482	hsa-miR-4780	CLIP-seq
MIRT2616483	hsa-miR-4789-3p	CLIP-seq
MIRT2616484	hsa-miR-4802-3p	CLIP-seq
MIRT2616485	hsa-miR-518a-5p	CLIP-seq
MIRT2616486	hsa-miR-519d	CLIP-seq
MIRT2616487	hsa-miR-527	CLIP-seq
MIRT2616488	hsa-miR-543	CLIP-seq
MIRT2616489	hsa-miR-548a-5p	CLIP-seq
MIRT2616490	hsa-miR-548ab	CLIP-seq
MIRT2616491	hsa-miR-548ak	CLIP-seq
MIRT2616492	hsa-miR-548b-5p	CLIP-seq
MIRT2616493	hsa-miR-548c-5p	CLIP-seq
MIRT2616494	hsa-miR-548d-5p	CLIP-seq
MIRT2616495	hsa-miR-548h	CLIP-seq
MIRT2616496	hsa-miR-548i	CLIP-seq
MIRT2616497	hsa-miR-548j	CLIP-seq
MIRT2616498	hsa-miR-548k	CLIP-seq
MIRT2616499	hsa-miR-548l	CLIP-seq
MIRT2616500	hsa-miR-548n	CLIP-seq
MIRT2616501	hsa-miR-548t	CLIP-seq
MIRT2616502	hsa-miR-548w	CLIP-seq
MIRT2616503	hsa-miR-548y	CLIP-seq
MIRT2616504	hsa-miR-559	CLIP-seq
MIRT2616505	hsa-miR-561	CLIP-seq
MIRT2616506	hsa-miR-579	CLIP-seq
MIRT2616507	hsa-miR-602	CLIP-seq
MIRT2616508	hsa-miR-623	CLIP-seq
MIRT2616509	hsa-miR-632	CLIP-seq
MIRT2616510	hsa-miR-93	CLIP-seq
MIRT2616415	hsa-miR-106a	CLIP-seq
MIRT2616416	hsa-miR-106b	CLIP-seq
MIRT2616418	hsa-miR-1260	CLIP-seq
MIRT2616419	hsa-miR-1260b	CLIP-seq
MIRT2616421	hsa-miR-127-3p	CLIP-seq
MIRT2616422	hsa-miR-1279	CLIP-seq
MIRT2616423	hsa-miR-1293	CLIP-seq
MIRT2616424	hsa-miR-130a	CLIP-seq
MIRT2616425	hsa-miR-130b	CLIP-seq
MIRT2616426	hsa-miR-148a	CLIP-seq
MIRT2616427	hsa-miR-148b	CLIP-seq
MIRT2616428	hsa-miR-151-3p	CLIP-seq
MIRT2616429	hsa-miR-152	CLIP-seq
MIRT2616430	hsa-miR-155	CLIP-seq
MIRT2616431	hsa-miR-17	CLIP-seq
MIRT2616432	hsa-miR-181a	CLIP-seq
MIRT2616433	hsa-miR-181b	CLIP-seq
MIRT2616434	hsa-miR-181c	CLIP-seq
MIRT2616435	hsa-miR-181d	CLIP-seq
MIRT2616436	hsa-miR-188-3p	CLIP-seq
MIRT2616437	hsa-miR-19a	CLIP-seq
MIRT2616438	hsa-miR-19b	CLIP-seq
MIRT2616440	hsa-miR-20a	CLIP-seq
MIRT2616441	hsa-miR-20b	CLIP-seq
MIRT2616442	hsa-miR-24	CLIP-seq
MIRT2616443	hsa-miR-301a	CLIP-seq
MIRT2616444	hsa-miR-301b	CLIP-seq
MIRT2616445	hsa-miR-3065-5p	CLIP-seq
MIRT2616447	hsa-miR-3140-3p	CLIP-seq
MIRT2616448	hsa-miR-3146	CLIP-seq
MIRT2616449	hsa-miR-3156-3p	CLIP-seq
MIRT2616450	hsa-miR-3162-3p	CLIP-seq
MIRT1553212	hsa-miR-330-3p	CLIP-seq
MIRT2616451	hsa-miR-3613-3p	CLIP-seq
MIRT2616452	hsa-miR-3653	CLIP-seq
MIRT2616453	hsa-miR-3658	CLIP-seq
MIRT2616454	hsa-miR-3666	CLIP-seq
MIRT2616455	hsa-miR-3684	CLIP-seq
MIRT2616456	hsa-miR-3688-3p	CLIP-seq
MIRT2616457	hsa-miR-377	CLIP-seq
MIRT2616458	hsa-miR-4261	CLIP-seq
MIRT2616459	hsa-miR-4262	CLIP-seq
MIRT2616461	hsa-miR-4284	CLIP-seq
MIRT2616462	hsa-miR-4287	CLIP-seq
MIRT2616464	hsa-miR-4295	CLIP-seq
MIRT2616465	hsa-miR-4469	CLIP-seq
MIRT2616466	hsa-miR-4477b	CLIP-seq
MIRT2616467	hsa-miR-4483	CLIP-seq
MIRT2616469	hsa-miR-454	CLIP-seq
MIRT2616470	hsa-miR-4639-5p	CLIP-seq
MIRT2616471	hsa-miR-4643	CLIP-seq
MIRT2616474	hsa-miR-466	CLIP-seq
MIRT2616475	hsa-miR-4666-5p	CLIP-seq
MIRT2616477	hsa-miR-4685-3p	CLIP-seq
MIRT2616478	hsa-miR-4685-5p	CLIP-seq
MIRT2616479	hsa-miR-4694-5p	CLIP-seq
MIRT2616480	hsa-miR-4757-5p	CLIP-seq
MIRT2616481	hsa-miR-4766-5p	CLIP-seq
MIRT2616482	hsa-miR-4780	CLIP-seq
MIRT2616483	hsa-miR-4789-3p	CLIP-seq
MIRT2616484	hsa-miR-4802-3p	CLIP-seq
MIRT2616486	hsa-miR-519d	CLIP-seq
MIRT2616488	hsa-miR-543	CLIP-seq
MIRT2616489	hsa-miR-548a-5p	CLIP-seq
MIRT2616490	hsa-miR-548ab	CLIP-seq
MIRT2616491	hsa-miR-548ak	CLIP-seq
MIRT2616492	hsa-miR-548b-5p	CLIP-seq
MIRT2690112	hsa-miR-548c-3p	CLIP-seq
MIRT2616493	hsa-miR-548c-5p	CLIP-seq
MIRT2616494	hsa-miR-548d-5p	CLIP-seq
MIRT2616495	hsa-miR-548h	CLIP-seq
MIRT2616496	hsa-miR-548i	CLIP-seq
MIRT2616497	hsa-miR-548j	CLIP-seq
MIRT2616498	hsa-miR-548k	CLIP-seq
MIRT2616499	hsa-miR-548l	CLIP-seq
MIRT2616500	hsa-miR-548n	CLIP-seq
MIRT2616501	hsa-miR-548t	CLIP-seq
MIRT2616502	hsa-miR-548w	CLIP-seq
MIRT2616503	hsa-miR-548y	CLIP-seq
MIRT2616504	hsa-miR-559	CLIP-seq
MIRT2616505	hsa-miR-561	CLIP-seq
MIRT2616506	hsa-miR-579	CLIP-seq
MIRT2616508	hsa-miR-623	CLIP-seq
MIRT2616510	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Activation	21102457

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001664	Function	G protein-coupled receptor binding	IPI	24851274
GO:0001955	Process	Blood vessel maturation	IEA
GO:0001955	Process	Blood vessel maturation	ISS
GO:0003245	Process	Cardiac muscle tissue growth involved in heart morphogenesis	IEA
GO:0003245	Process	Cardiac muscle tissue growth involved in heart morphogenesis	ISS
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IBA
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IDA	22344443
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8626678
GO:0005515	Function	Protein binding	IPI	16525420
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22344443
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8626678
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	ISS
GO:0007155	Process	Cell adhesion	TAS	9488656, 10555146
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8626678
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007420	Process	Brain development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016477	Process	Cell migration	ISS
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030032	Process	Lamellipodium assembly	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030500	Process	Regulation of bone mineralization	IEA
GO:0030500	Process	Regulation of bone mineralization	ISS
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IBA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IDA	22344443
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045124	Process	Regulation of bone resorption	IEA
GO:0045124	Process	Regulation of bone resorption	ISS
GO:0045446	Process	Endothelial cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046625	Function	Sphingolipid binding	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050927	Process	Positive regulation of positive chemotaxis	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	IEA
GO:0061384	Process	Heart trabecula morphogenesis	IEA
GO:0061384	Process	Heart trabecula morphogenesis	ISS
GO:0072678	Process	T cell migration	IDA	20829352
GO:0072678	Process	T cell migration	IDA	37039481
GO:0072678	Process	T cell migration	IEA
GO:0072678	Process	T cell migration	ISS
GO:0098793	Component	Presynapse	IEA

Other IDs

• MIM: 601974
• HGNC: 3165
• e!Ensembl: ENSG00000170989

Protein

• UniProt ID: P21453
• Protein name: Sphingosine 1-phosphate receptor 1 (S1P receptor 1) (S1P1) (Endothelial differentiation G-protein coupled receptor 1) (Sphingosine 1-phosphate receptor Edg-1) (S1P receptor Edg-1) (CD antigen CD363)
• Protein function: G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays
• PDB: 3V2W, 3V2Y, 7EO2, 7EO4, 7EVY, 7EVZ, 7EW0, 7EW7, 7TD3, 7TD4, 7VIE, 7VIF, 7VIG, 7VIH, 7WF7, 8G94, 8YIC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	62 → 311	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.
• Sequence:

  MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
  LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
  EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
  GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
  ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
  VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
  PQKDEGDNPETIMSSGNVNSSS

• Sequence length: 382

Pathways

KEGG:

FoxO signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Efferocytosis

Reactome:

G alpha (i) signalling events
Lysosphingolipid and LPA receptors
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR SYSTEM INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15788668		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23111975, 31558162		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27061580		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33788842	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29551975		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	30889317	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	29401601		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26268607, 29134505, 29244772, 30627532		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22131329, 22992945, 31607926		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16508938, 18658144, 22326262	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20624651, 30409535		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20624651	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18765664	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26268607, 29134505, 29244772, 30627532		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15699128, 23589284, 24076635, 24780445, 25293589, 29193293, 29310513, 30782260, 31202617		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23674616, 31968593	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15788668		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24387768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	24387768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	24387768	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30718502		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	31935914	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28121348, 28982858, 29351902, 30814488, 31115798		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20889557, 24263101, 28121348, 28224210, 29923327, 31935914	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32799825	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32799825, 34301921	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27556509, 34301921, 36068200	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30712233, 30718502		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32799825	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	37882753	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	30836997	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29337049		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	35563301	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23033271, 25632006, 26282174		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29749428		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31534132		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24972972, 28121348, 31534132	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31534132		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23969695, 28338096		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30787172		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31968593	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	33788842	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	37882753	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31357710		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22480845	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22916176, 24751283	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31602216		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29757216		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	22916176	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27061580		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22277765		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22277765, 32907751, 36524127	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24903384, 30185625		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24903384	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26887055	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24903384, 30185625		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17376432	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	36071219	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22916176	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23969695, 28338096		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	29556671		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	31115798		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	23419711, 28878352	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25673082		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	22326262	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28607130		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	17437622		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19240180, 33788630	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17437622		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27049060		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	31357710		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29345349		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18477771, 36071219	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22098666, 24631531, 24798342, 30377291		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24798342		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30082521, 36380607	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23028528, 37858140	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25911753		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27197189		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	27389057	Associate	★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	31603362		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	28716816		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28121348, 28982858, 29351902, 30814488, 31115798		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29750961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29036438, 30316864, 30453284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30718502		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28668852, 30316864, 30712233, 31115798, 31490328		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28739604, 29351902		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	20035722		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22480845	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	37882753, 38287231	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34092610	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22711564		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27405725	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19814729, 20648639, 23204443, 24076635, 24511991, 27638335, 29140922, 30083262, 30409535, 31490328		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	24511991, 31968593, 32322257, 37882753	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	29193293, 30407868, 30484906, 31049553		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31276786		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20035722, 21102457, 22098666, 22624714, 24631531, 28224210, 28739604, 29750961, 30091994, 30281914, 30316864, 30712233, 30718502, 31534132, 31825830		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28077289, 28716816		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26482537		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29377379		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	28379469		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37828220	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14599962		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24511991	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	25692679	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26932498		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	31359035		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30143424, 31357710		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30787172		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	30712389		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18658144		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22326262, 30402334, 30970641		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24387768		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	24387768	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	15710622	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28538086		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	18209090	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31438989		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29380527		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29036438, 30316864, 30453284		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30106120	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26820677		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	27061580	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	26830367		★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	25971967	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27049060, 28147349, 29608575		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34873055	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	33788630	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wilms Tumor	Wilms tumor	Pubtator	19131156	Associate	★☆☆☆☆ Found in Text Mining only