Gene Gene information from NCBI Gene database.
Entrez ID 1896
Gene name Ectodysplasin A
Gene symbol EDA
Synonyms (NCBI Gene)
ECTD1ED1ED1-A1ED1-A2EDA-A1EDA-A2EDA1EDA2HEDHED1ODT1STHAGX1TNLG7CXHEDXLHED
Chromosome X
Chromosome location Xq13.1
Summary The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling
SNPs SNP information provided by dbSNP.
106
SNP ID Visualize variation Clinical significance Consequence
rs132630308 T>A,C Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs132630309 G>T Conflicting-interpretations-of-pathogenicity, benign, benign-likely-benign Coding sequence variant, non coding transcript variant, missense variant
rs132630310 C>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs132630311 G>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs132630312 C>T Pathogenic Coding sequence variant, missense variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
168
miRTarBase ID miRNA Experiments Reference
MIRT051411 hsa-let-7f-5p CLASH 23622248
MIRT951892 hsa-let-7a CLIP-seq
MIRT951893 hsa-let-7b CLIP-seq
MIRT951894 hsa-let-7c CLIP-seq
MIRT951895 hsa-let-7d CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
LEF1 Unknown 12039047
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
51
GO ID Ontology Definition Evidence Reference
GO:0001942 Process Hair follicle development IEA
GO:0005102 Function Signaling receptor binding IDA 11039935
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 10484778
GO:0005123 Function Death receptor binding IDA 27144394
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300451 3157 ENSG00000158813
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92838
Protein name Ectodysplasin-A (Ectodermal dysplasia protein) (EDA protein) [Cleaved into: Ectodysplasin-A, membrane form; Ectodysplasin-A, secreted form]
Protein function Cytokine which is involved in epithelial-mesenchymal signaling during morphogenesis of ectodermal organs. Functions as a ligand activating the DEATH-domain containing receptors EDAR and EDA2R (PubMed:11039935, PubMed:27144394, PubMed:34582123, P
PDB 1RJ7 , 1RJ8 , 7X9G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 272 385 TNF(Tumour Necrosis Factor) family Domain
Tissue specificity TISSUE SPECIFICITY: Not abundant; expressed in specific cell types of ectodermal (but not mesodermal) origin of keratinocytes, hair follicles, sweat glands. Also in adult heart, liver, muscle, pancreas, prostate, fetal liver, uterus, small intestine and u
Sequence
MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCC
YLELRSELRRERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGE
AALHSDSQDGHQMALLNFFFPDEKPYSEEESRRVRRNKRSKSNEGADGPVKNKKKGKKAG
PPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADK
AGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGT
YFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKI
AVKMVHADISINMSKHTTFFGAIRL
GEAPAS
Sequence length 391
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
  TNFs bind their physiological receptors
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
21
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Anhidrotic ectodermal dysplasia Pathogenic; Likely pathogenic rs876657686, rs876657641, rs397516662, rs397516677 RCV003235137
RCV003317157
RCV003478983
RCV003398602
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ectodermal dysplasia Likely pathogenic; Pathogenic rs876657641, rs132630314, rs387907197 RCV005860039
RCV005859327
RCV000626808
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EDA-related disorder Pathogenic; Likely pathogenic rs2147511678, rs876657685, rs886039347, rs132630313, rs2520343091, rs2520346795, rs1556098570, rs397516654, rs397516668, rs397516672, rs397516682 RCV003399399
RCV004754361
RCV004730918
RCV003390668
RCV003410507
View all (6 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypodontia Likely pathogenic; Pathogenic rs876657641, rs397516654 RCV000223248
RCV000037161
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANDROGENETIC ALOPECIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANHYDROTIC ECTODERMAL DYSPLASIAS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asphyxiating thoracic dystrophy 3 Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRIST-SIEMENS-TOURAINE SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Absent eyebrow Absent eyebrow HPO_DG
★☆☆☆☆
Found in Text Mining only
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 23622001
★☆☆☆☆
Found in Text Mining only
Alopecia Alopecia BEFREE 31607478
★☆☆☆☆
Found in Text Mining only
Aneuploidy Aneuploidy Pubtator 30067729 Associate
★☆☆☆☆
Found in Text Mining only
Anhidrosis Anhidrosis BEFREE 21357618
★☆☆☆☆
Found in Text Mining only
Anhidrosis Anhidrosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Anhydrotic Ectodermal Dysplasias Hypohidrotic ectodermal dysplasia BEFREE 11591646, 12673367, 18816645, 25758344, 9245989, 9701517
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Anhydrotic Ectodermal Dysplasias Hypohidrotic ectodermal dysplasia CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Anodontia Anodontia Pubtator 18545687, 19623212, 22581971, 23227268, 23991204, 24312213, 24631698, 27049303, 30605838, 31652981, 31914153, 33205897, 33622384, 33943035, 38280992
View all (1 more)
Associate
★☆☆☆☆
Found in Text Mining only
Anodontia of Permanent Dentition Anodontia Pubtator 20486090 Associate
★☆☆☆☆
Found in Text Mining only