Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1879
Gene name	EBF transcription factor 1
Gene symbol	EBF1
Synonyms (NCBI Gene)	COE1EBFO/E-1OLF1
Chromosome	5
Chromosome location	5q33.3

248

Show/Hide all (248)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018619	hsa-miR-335-5p	Microarray	18185580
MIRT624076	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT624075	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT624074	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT624073	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT624072	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT624076	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT624076	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT624075	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT624074	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT624073	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT624072	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT951319	hsa-miR-1252	CLIP-seq
MIRT951320	hsa-miR-1267	CLIP-seq
MIRT951321	hsa-miR-1269	CLIP-seq
MIRT951322	hsa-miR-1269b	CLIP-seq
MIRT951323	hsa-miR-1289	CLIP-seq
MIRT951324	hsa-miR-142-3p	CLIP-seq
MIRT951325	hsa-miR-216b	CLIP-seq
MIRT951326	hsa-miR-3121-3p	CLIP-seq
MIRT951327	hsa-miR-3125	CLIP-seq
MIRT951328	hsa-miR-3154	CLIP-seq
MIRT951329	hsa-miR-3185	CLIP-seq
MIRT951330	hsa-miR-3192	CLIP-seq
MIRT951331	hsa-miR-3198	CLIP-seq
MIRT951332	hsa-miR-3199	CLIP-seq
MIRT951333	hsa-miR-3202	CLIP-seq
MIRT951334	hsa-miR-326	CLIP-seq
MIRT951335	hsa-miR-330-5p	CLIP-seq
MIRT951336	hsa-miR-3620	CLIP-seq
MIRT951337	hsa-miR-3622b-5p	CLIP-seq
MIRT951338	hsa-miR-3647-3p	CLIP-seq
MIRT951339	hsa-miR-3657	CLIP-seq
MIRT951340	hsa-miR-3916	CLIP-seq
MIRT951341	hsa-miR-3936	CLIP-seq
MIRT951342	hsa-miR-4282	CLIP-seq
MIRT951343	hsa-miR-4294	CLIP-seq
MIRT951344	hsa-miR-4309	CLIP-seq
MIRT951345	hsa-miR-4314	CLIP-seq
MIRT951346	hsa-miR-4325	CLIP-seq
MIRT951347	hsa-miR-4436b-5p	CLIP-seq
MIRT951348	hsa-miR-448	CLIP-seq
MIRT951349	hsa-miR-4484	CLIP-seq
MIRT951350	hsa-miR-4520b-3p	CLIP-seq
MIRT951351	hsa-miR-4529-3p	CLIP-seq
MIRT951352	hsa-miR-4533	CLIP-seq
MIRT951353	hsa-miR-4639-5p	CLIP-seq
MIRT951354	hsa-miR-4643	CLIP-seq
MIRT951355	hsa-miR-4646-5p	CLIP-seq
MIRT951356	hsa-miR-4651	CLIP-seq
MIRT951357	hsa-miR-466	CLIP-seq
MIRT951358	hsa-miR-4668-5p	CLIP-seq
MIRT951359	hsa-miR-4742-3p	CLIP-seq
MIRT951360	hsa-miR-4761-5p	CLIP-seq
MIRT951361	hsa-miR-4789-3p	CLIP-seq
MIRT951362	hsa-miR-4789-5p	CLIP-seq
MIRT951363	hsa-miR-4793-3p	CLIP-seq
MIRT951364	hsa-miR-4802-3p	CLIP-seq
MIRT951365	hsa-miR-548an	CLIP-seq
MIRT951366	hsa-miR-548n	CLIP-seq
MIRT951367	hsa-miR-548t	CLIP-seq
MIRT951368	hsa-miR-608	CLIP-seq
MIRT951369	hsa-miR-633	CLIP-seq
MIRT951370	hsa-miR-9	CLIP-seq
MIRT951371	hsa-miR-924	CLIP-seq
MIRT951372	hsa-miR-935	CLIP-seq
MIRT951319	hsa-miR-1252	CLIP-seq
MIRT951327	hsa-miR-3125	CLIP-seq
MIRT951328	hsa-miR-3154	CLIP-seq
MIRT1981807	hsa-miR-3180-5p	CLIP-seq
MIRT951329	hsa-miR-3185	CLIP-seq
MIRT1981808	hsa-miR-3190	CLIP-seq
MIRT951333	hsa-miR-3202	CLIP-seq
MIRT951340	hsa-miR-3916	CLIP-seq
MIRT1981809	hsa-miR-4303	CLIP-seq
MIRT951352	hsa-miR-4533	CLIP-seq
MIRT951356	hsa-miR-4651	CLIP-seq
MIRT951368	hsa-miR-608	CLIP-seq
MIRT2216658	hsa-miR-3168	CLIP-seq
MIRT2216659	hsa-miR-361-3p	CLIP-seq
MIRT2216660	hsa-miR-3679-3p	CLIP-seq
MIRT2216661	hsa-miR-4446-5p	CLIP-seq
MIRT2216662	hsa-miR-450b-5p	CLIP-seq
MIRT2216658	hsa-miR-3168	CLIP-seq
MIRT2520512	hsa-miR-1	CLIP-seq
MIRT2520513	hsa-miR-10a	CLIP-seq
MIRT2520514	hsa-miR-10b	CLIP-seq
MIRT2520515	hsa-miR-1227	CLIP-seq
MIRT2520516	hsa-miR-124	CLIP-seq
MIRT2520517	hsa-miR-1254	CLIP-seq
MIRT2520518	hsa-miR-1256	CLIP-seq
MIRT2520519	hsa-miR-1275	CLIP-seq
MIRT2520520	hsa-miR-1294	CLIP-seq
MIRT2520521	hsa-miR-1299	CLIP-seq
MIRT2520522	hsa-miR-138	CLIP-seq
MIRT2520523	hsa-miR-144	CLIP-seq
MIRT2520524	hsa-miR-155	CLIP-seq
MIRT2520525	hsa-miR-1827	CLIP-seq
MIRT2520526	hsa-miR-203	CLIP-seq
MIRT2520527	hsa-miR-2053	CLIP-seq
MIRT2520528	hsa-miR-206	CLIP-seq
MIRT2520529	hsa-miR-2682	CLIP-seq
MIRT2520530	hsa-miR-299-5p	CLIP-seq
MIRT2520531	hsa-miR-300	CLIP-seq
MIRT2520532	hsa-miR-3116	CLIP-seq
MIRT2520533	hsa-miR-3117-3p	CLIP-seq
MIRT951327	hsa-miR-3125	CLIP-seq
MIRT2520534	hsa-miR-3126-3p	CLIP-seq
MIRT2520535	hsa-miR-3140-3p	CLIP-seq
MIRT2520536	hsa-miR-3153	CLIP-seq
MIRT1981808	hsa-miR-3190	CLIP-seq
MIRT2520537	hsa-miR-331-5p	CLIP-seq
MIRT2520538	hsa-miR-337-3p	CLIP-seq
MIRT2520539	hsa-miR-33a	CLIP-seq
MIRT2520540	hsa-miR-33b	CLIP-seq
MIRT2520541	hsa-miR-3616-3p	CLIP-seq
MIRT2520542	hsa-miR-3646	CLIP-seq
MIRT2520543	hsa-miR-3653	CLIP-seq
MIRT2520544	hsa-miR-3658	CLIP-seq
MIRT2520545	hsa-miR-3673	CLIP-seq
MIRT2520546	hsa-miR-3690	CLIP-seq
MIRT2520547	hsa-miR-3714	CLIP-seq
MIRT2520548	hsa-miR-374c	CLIP-seq
MIRT2520549	hsa-miR-377	CLIP-seq
MIRT2520550	hsa-miR-381	CLIP-seq
MIRT2520551	hsa-miR-3910	CLIP-seq
MIRT2520552	hsa-miR-3911	CLIP-seq
MIRT951340	hsa-miR-3916	CLIP-seq
MIRT2520553	hsa-miR-4277	CLIP-seq
MIRT2520554	hsa-miR-4280	CLIP-seq
MIRT2520555	hsa-miR-4299	CLIP-seq
MIRT2520556	hsa-miR-4436b-3p	CLIP-seq
MIRT2520557	hsa-miR-4456	CLIP-seq
MIRT2520558	hsa-miR-449c	CLIP-seq
MIRT2520559	hsa-miR-4501	CLIP-seq
MIRT2520560	hsa-miR-4517	CLIP-seq
MIRT2520561	hsa-miR-4525	CLIP-seq
MIRT2520562	hsa-miR-4529-5p	CLIP-seq
MIRT2520563	hsa-miR-4645-3p	CLIP-seq
MIRT2520564	hsa-miR-4662a-3p	CLIP-seq
MIRT2520565	hsa-miR-4665-5p	CLIP-seq
MIRT2520566	hsa-miR-4666-3p	CLIP-seq
MIRT951358	hsa-miR-4668-5p	CLIP-seq
MIRT2520567	hsa-miR-4678	CLIP-seq
MIRT2520568	hsa-miR-4686	CLIP-seq
MIRT2520569	hsa-miR-4698	CLIP-seq
MIRT2520570	hsa-miR-4715-3p	CLIP-seq
MIRT2520571	hsa-miR-4723-5p	CLIP-seq
MIRT2520572	hsa-miR-4725-5p	CLIP-seq
MIRT2520573	hsa-miR-4738-3p	CLIP-seq
MIRT2520574	hsa-miR-4771	CLIP-seq
MIRT2520575	hsa-miR-4778-5p	CLIP-seq
MIRT2520576	hsa-miR-494	CLIP-seq
MIRT2520577	hsa-miR-499a-5p	CLIP-seq
MIRT2520578	hsa-miR-504	CLIP-seq
MIRT2520579	hsa-miR-506	CLIP-seq
MIRT2520580	hsa-miR-516a-5p	CLIP-seq
MIRT2520581	hsa-miR-518a-5p	CLIP-seq
MIRT2520582	hsa-miR-527	CLIP-seq
MIRT2520583	hsa-miR-548c-3p	CLIP-seq
MIRT2520584	hsa-miR-548l	CLIP-seq
MIRT2520585	hsa-miR-548q	CLIP-seq
MIRT2520586	hsa-miR-550a	CLIP-seq
MIRT2520587	hsa-miR-574-5p	CLIP-seq
MIRT2520588	hsa-miR-582-3p	CLIP-seq
MIRT2520589	hsa-miR-613	CLIP-seq
MIRT2520590	hsa-miR-625	CLIP-seq
MIRT2520591	hsa-miR-651	CLIP-seq
MIRT2520592	hsa-miR-655	CLIP-seq
MIRT2520593	hsa-miR-661	CLIP-seq
MIRT2520594	hsa-miR-7	CLIP-seq
MIRT2520595	hsa-miR-711	CLIP-seq
MIRT2520596	hsa-miR-759	CLIP-seq
MIRT2520597	hsa-miR-875-3p	CLIP-seq
MIRT951372	hsa-miR-935	CLIP-seq
MIRT2520598	hsa-miR-939	CLIP-seq
MIRT2520512	hsa-miR-1	CLIP-seq
MIRT2520515	hsa-miR-1227	CLIP-seq
MIRT2520516	hsa-miR-124	CLIP-seq
MIRT2520518	hsa-miR-1256	CLIP-seq
MIRT2520519	hsa-miR-1275	CLIP-seq
MIRT2520520	hsa-miR-1294	CLIP-seq
MIRT2520521	hsa-miR-1299	CLIP-seq
MIRT2520522	hsa-miR-138	CLIP-seq
MIRT2520523	hsa-miR-144	CLIP-seq
MIRT2520524	hsa-miR-155	CLIP-seq
MIRT2520525	hsa-miR-1827	CLIP-seq
MIRT2520526	hsa-miR-203	CLIP-seq
MIRT2520527	hsa-miR-2053	CLIP-seq
MIRT2520528	hsa-miR-206	CLIP-seq
MIRT2520529	hsa-miR-2682	CLIP-seq
MIRT2520530	hsa-miR-299-5p	CLIP-seq
MIRT2520531	hsa-miR-300	CLIP-seq
MIRT2520533	hsa-miR-3117-3p	CLIP-seq
MIRT951327	hsa-miR-3125	CLIP-seq
MIRT2520534	hsa-miR-3126-3p	CLIP-seq
MIRT2520535	hsa-miR-3140-3p	CLIP-seq
MIRT2520536	hsa-miR-3153	CLIP-seq
MIRT1981808	hsa-miR-3190	CLIP-seq
MIRT2520537	hsa-miR-331-5p	CLIP-seq
MIRT2520538	hsa-miR-337-3p	CLIP-seq
MIRT2520539	hsa-miR-33a	CLIP-seq
MIRT2520540	hsa-miR-33b	CLIP-seq
MIRT2520541	hsa-miR-3616-3p	CLIP-seq
MIRT2520542	hsa-miR-3646	CLIP-seq
MIRT2520545	hsa-miR-3673	CLIP-seq
MIRT2520547	hsa-miR-3714	CLIP-seq
MIRT2520549	hsa-miR-377	CLIP-seq
MIRT2520550	hsa-miR-381	CLIP-seq
MIRT2520551	hsa-miR-3910	CLIP-seq
MIRT2520552	hsa-miR-3911	CLIP-seq
MIRT951340	hsa-miR-3916	CLIP-seq
MIRT2520553	hsa-miR-4277	CLIP-seq
MIRT2520555	hsa-miR-4299	CLIP-seq
MIRT2520556	hsa-miR-4436b-3p	CLIP-seq
MIRT2520557	hsa-miR-4456	CLIP-seq
MIRT2520558	hsa-miR-449c	CLIP-seq
MIRT2520559	hsa-miR-4501	CLIP-seq
MIRT2520560	hsa-miR-4517	CLIP-seq
MIRT2520561	hsa-miR-4525	CLIP-seq
MIRT2520562	hsa-miR-4529-5p	CLIP-seq
MIRT2520563	hsa-miR-4645-3p	CLIP-seq
MIRT2520564	hsa-miR-4662a-3p	CLIP-seq
MIRT2520565	hsa-miR-4665-5p	CLIP-seq
MIRT2520566	hsa-miR-4666-3p	CLIP-seq
MIRT951358	hsa-miR-4668-5p	CLIP-seq
MIRT2520567	hsa-miR-4678	CLIP-seq
MIRT2520568	hsa-miR-4686	CLIP-seq
MIRT2520569	hsa-miR-4698	CLIP-seq
MIRT2520570	hsa-miR-4715-3p	CLIP-seq
MIRT2520571	hsa-miR-4723-5p	CLIP-seq
MIRT2520573	hsa-miR-4738-3p	CLIP-seq
MIRT2520575	hsa-miR-4778-5p	CLIP-seq
MIRT2520579	hsa-miR-506	CLIP-seq
MIRT2520580	hsa-miR-516a-5p	CLIP-seq
MIRT2520581	hsa-miR-518a-5p	CLIP-seq
MIRT2520582	hsa-miR-527	CLIP-seq
MIRT2520585	hsa-miR-548q	CLIP-seq
MIRT2520587	hsa-miR-574-5p	CLIP-seq
MIRT2520588	hsa-miR-582-3p	CLIP-seq
MIRT2520589	hsa-miR-613	CLIP-seq
MIRT2520590	hsa-miR-625	CLIP-seq
MIRT2520591	hsa-miR-651	CLIP-seq
MIRT2520594	hsa-miR-7	CLIP-seq
MIRT2520596	hsa-miR-759	CLIP-seq
MIRT2520597	hsa-miR-875-3p	CLIP-seq
MIRT951372	hsa-miR-935	CLIP-seq
MIRT2520598	hsa-miR-939	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
164343	3126	ENSG00000164330

Q9UH73

Protein name

Transcription factor COE1 (O/E-1) (OE-1) (Early B-cell factor)

Protein function

Key pioneer transcription factor of B-cell specification and commitment (PubMed:27807034). Recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'. Operates in a transcription factor network to activate B-cell-specific genes and

PDB

3LYR , 3MQI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16422	COE1_DBD	17 → 247	Transcription factor COE1 DNA-binding domain	Domain
PF01833	TIG	262 → 344	IPT/TIG domain	Domain
PF16423	COE1_HLH	347 → 390	Transcription factor COE1 helix-loop-helix domain	Domain

Sequence

MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLV
WSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQ
KVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ
LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTN
YNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGI
FSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM

Sequence length

591

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (31)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLEPHARITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, FOLLICULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (101)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	25990863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21606506, 22851563, 25044358, 26872634, 28476192, 29552179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21606506, 22851563, 26872634, 28476192, 29552179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	23174882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 1	Androgenetic Alopecia	GWASCAT_DG	27182965, 29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 2	Androgenetic Alopecia	GWASCAT_DG	27182965, 29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 3	Androgenetic Alopecia	GWASCAT_DG	27182965, 29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASCAT_DG	27182965, 29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	GWASCAT_DG	27182965, 29146897		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia	BEFREE	28630421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia	GWASCAT_DG	28630421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	24626634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24626634		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	30109601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30878028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30335886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	33369444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26872634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 25751625, 29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	25862352, 29099283		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24325915, 25862352, 27863437, 29099283, 39796183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	32054837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24970810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33932757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30896821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25271088, 30642433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18768390, 21606506, 22851563, 26872634, 28476192, 29552179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29169115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23091163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34561436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31281542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30896821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29169115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of kidney	Renal hypoplasia	BEFREE	31405952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28183271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22369142, 28183271, 29789399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22369142, 28183271, 29789399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	23539213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28183271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34561436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	30642433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28183271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25271088, 28183271	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28183271		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25271088, 33077726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	30885419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	39796183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	23174882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27166193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension Orthostatic	Orthostatic hypotension	Pubtator	22504314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	26252872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	39180924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15815718, 22472950, 26788497, 27913602, 29181981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35182476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22581002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25748621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27884639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30642433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20359360, 36165173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31430064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15544702, 24970810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24362818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	CTD_human_DG	24362818		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular, Grade 1	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 2	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 3	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Cleaved-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25862352, 29099283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26788497, 29169115		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25848976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25848976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25271088	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16255771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16255771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16255771, 34561436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30335886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30420297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30420297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16276091, 20015323, 23775715, 29169115		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	16255771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15544702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25271088, 33077726, 33420178	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	27744667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35761386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	28692033, 29181981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21606506, 25044358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	24970810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36834602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32364535, 36397644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	31430064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	34982424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24325915, 27863437, 35867755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32420368, 33184436, 37664915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	GWASCAT_DG	30566020, 30998689		★★★★★ ★☆☆☆☆ Found in Text Mining only

EBF1 (EBF transcription factor 1)