Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1874
Gene name	E2F transcription factor 4
Gene symbol	E2F4
Synonyms (NCBI Gene)	E2F-4
Chromosome	16
Chromosome location	16q22.1
Summary	The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DN

171

Show/Hide all (171)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022270	hsa-miR-124-3p	Microarray	18668037
MIRT048712	hsa-miR-98-5p	CLASH	23622248
MIRT048137	hsa-miR-197-3p	CLASH	23622248
MIRT046375	hsa-miR-23b-3p	CLASH	23622248
MIRT039886	hsa-miR-615-3p	CLASH	23622248
MIRT440754	hsa-miR-377-5p	HITS-CLIP	24374217
MIRT440754	hsa-miR-377-5p	HITS-CLIP	24374217
MIRT950551	hsa-miR-1183	CLIP-seq
MIRT950552	hsa-miR-1205	CLIP-seq
MIRT950553	hsa-miR-1237	CLIP-seq
MIRT950554	hsa-miR-1248	CLIP-seq
MIRT950555	hsa-miR-1252	CLIP-seq
MIRT950556	hsa-miR-141	CLIP-seq
MIRT950557	hsa-miR-1470	CLIP-seq
MIRT950558	hsa-miR-147b	CLIP-seq
MIRT950559	hsa-miR-1912	CLIP-seq
MIRT950560	hsa-miR-200a	CLIP-seq
MIRT950561	hsa-miR-214	CLIP-seq
MIRT950562	hsa-miR-216b	CLIP-seq
MIRT950563	hsa-miR-2276	CLIP-seq
MIRT950564	hsa-miR-2355-5p	CLIP-seq
MIRT950565	hsa-miR-28-5p	CLIP-seq
MIRT950566	hsa-miR-298	CLIP-seq
MIRT950567	hsa-miR-3115	CLIP-seq
MIRT950568	hsa-miR-3135b	CLIP-seq
MIRT950569	hsa-miR-3139	CLIP-seq
MIRT950570	hsa-miR-3158-3p	CLIP-seq
MIRT950571	hsa-miR-3163	CLIP-seq
MIRT950572	hsa-miR-3184	CLIP-seq
MIRT950573	hsa-miR-3607-3p	CLIP-seq
MIRT950574	hsa-miR-3614-3p	CLIP-seq
MIRT950575	hsa-miR-3614-5p	CLIP-seq
MIRT950576	hsa-miR-3619-5p	CLIP-seq
MIRT950577	hsa-miR-3622b-5p	CLIP-seq
MIRT950578	hsa-miR-3646	CLIP-seq
MIRT950579	hsa-miR-3665	CLIP-seq
MIRT950580	hsa-miR-3675-5p	CLIP-seq
MIRT950581	hsa-miR-3689d	CLIP-seq
MIRT950582	hsa-miR-3907	CLIP-seq
MIRT950583	hsa-miR-423-5p	CLIP-seq
MIRT950584	hsa-miR-4263	CLIP-seq
MIRT950585	hsa-miR-4300	CLIP-seq
MIRT950586	hsa-miR-4326	CLIP-seq
MIRT950587	hsa-miR-4423-3p	CLIP-seq
MIRT950588	hsa-miR-4434	CLIP-seq
MIRT950589	hsa-miR-4435	CLIP-seq
MIRT950590	hsa-miR-4446-3p	CLIP-seq
MIRT950591	hsa-miR-4459	CLIP-seq
MIRT950592	hsa-miR-4484	CLIP-seq
MIRT950593	hsa-miR-4487	CLIP-seq
MIRT950594	hsa-miR-4509	CLIP-seq
MIRT950595	hsa-miR-4516	CLIP-seq
MIRT950596	hsa-miR-4530	CLIP-seq
MIRT950597	hsa-miR-455-5p	CLIP-seq
MIRT950598	hsa-miR-4632	CLIP-seq
MIRT950599	hsa-miR-4640-5p	CLIP-seq
MIRT950600	hsa-miR-4667-3p	CLIP-seq
MIRT950601	hsa-miR-4693-5p	CLIP-seq
MIRT950602	hsa-miR-4709-3p	CLIP-seq
MIRT950603	hsa-miR-4710	CLIP-seq
MIRT950604	hsa-miR-4720-5p	CLIP-seq
MIRT950605	hsa-miR-4722-5p	CLIP-seq
MIRT950606	hsa-miR-4726-5p	CLIP-seq
MIRT950607	hsa-miR-4743	CLIP-seq
MIRT950608	hsa-miR-4746-3p	CLIP-seq
MIRT950609	hsa-miR-4755-3p	CLIP-seq
MIRT950610	hsa-miR-4772-3p	CLIP-seq
MIRT950611	hsa-miR-4786-3p	CLIP-seq
MIRT950612	hsa-miR-4799-3p	CLIP-seq
MIRT950613	hsa-miR-4799-5p	CLIP-seq
MIRT950614	hsa-miR-486-3p	CLIP-seq
MIRT950615	hsa-miR-548an	CLIP-seq
MIRT950616	hsa-miR-548c-3p	CLIP-seq
MIRT950617	hsa-miR-548l	CLIP-seq
MIRT950618	hsa-miR-548n	CLIP-seq
MIRT950619	hsa-miR-576-5p	CLIP-seq
MIRT950620	hsa-miR-642a	CLIP-seq
MIRT950621	hsa-miR-657	CLIP-seq
MIRT950622	hsa-miR-663b	CLIP-seq
MIRT950623	hsa-miR-665	CLIP-seq
MIRT950624	hsa-miR-708	CLIP-seq
MIRT950625	hsa-miR-761	CLIP-seq
MIRT950626	hsa-miR-765	CLIP-seq
MIRT950627	hsa-miR-769-5p	CLIP-seq
MIRT950628	hsa-miR-920	CLIP-seq
MIRT950629	hsa-miR-922	CLIP-seq
MIRT1981528	hsa-miR-1207-5p	CLIP-seq
MIRT1981529	hsa-miR-1293	CLIP-seq
MIRT1981530	hsa-miR-1324	CLIP-seq
MIRT1981531	hsa-miR-1587	CLIP-seq
MIRT1981532	hsa-miR-1913	CLIP-seq
MIRT950564	hsa-miR-2355-5p	CLIP-seq
MIRT1981533	hsa-miR-2467-5p	CLIP-seq
MIRT950565	hsa-miR-28-5p	CLIP-seq
MIRT950566	hsa-miR-298	CLIP-seq
MIRT950569	hsa-miR-3139	CLIP-seq
MIRT1981534	hsa-miR-3188	CLIP-seq
MIRT1981535	hsa-miR-3194-3p	CLIP-seq
MIRT1981536	hsa-miR-324-3p	CLIP-seq
MIRT1981537	hsa-miR-331-3p	CLIP-seq
MIRT1981538	hsa-miR-361-3p	CLIP-seq
MIRT950577	hsa-miR-3622b-5p	CLIP-seq
MIRT950580	hsa-miR-3675-5p	CLIP-seq
MIRT1981539	hsa-miR-378g	CLIP-seq
MIRT1981540	hsa-miR-3975	CLIP-seq
MIRT1981541	hsa-miR-4252	CLIP-seq
MIRT1981542	hsa-miR-4253	CLIP-seq
MIRT1981543	hsa-miR-4268	CLIP-seq
MIRT1981544	hsa-miR-4313	CLIP-seq
MIRT1981545	hsa-miR-4483	CLIP-seq
MIRT950593	hsa-miR-4487	CLIP-seq
MIRT1981546	hsa-miR-4488	CLIP-seq
MIRT1981547	hsa-miR-4492	CLIP-seq
MIRT1981548	hsa-miR-4498	CLIP-seq
MIRT1981549	hsa-miR-451b	CLIP-seq
MIRT1981550	hsa-miR-4533	CLIP-seq
MIRT1981551	hsa-miR-4645-5p	CLIP-seq
MIRT1981552	hsa-miR-4649-3p	CLIP-seq
MIRT1981553	hsa-miR-4656	CLIP-seq
MIRT1981554	hsa-miR-4660	CLIP-seq
MIRT1981555	hsa-miR-4673	CLIP-seq
MIRT1981556	hsa-miR-4675	CLIP-seq
MIRT1981557	hsa-miR-4691-3p	CLIP-seq
MIRT1981558	hsa-miR-4696	CLIP-seq
MIRT1981559	hsa-miR-4697-5p	CLIP-seq
MIRT1981560	hsa-miR-4726-3p	CLIP-seq
MIRT1981561	hsa-miR-4736	CLIP-seq
MIRT1981562	hsa-miR-4741	CLIP-seq
MIRT1981563	hsa-miR-4742-5p	CLIP-seq
MIRT1981564	hsa-miR-4761-3p	CLIP-seq
MIRT1981565	hsa-miR-4763-3p	CLIP-seq
MIRT1981566	hsa-miR-485-5p	CLIP-seq
MIRT1981567	hsa-miR-622	CLIP-seq
MIRT1981568	hsa-miR-661	CLIP-seq
MIRT950624	hsa-miR-708	CLIP-seq
MIRT1981569	hsa-miR-762	CLIP-seq
MIRT1981570	hsa-miR-873	CLIP-seq
MIRT1981571	hsa-miR-885-3p	CLIP-seq
MIRT1981530	hsa-miR-1324	CLIP-seq
MIRT950556	hsa-miR-141	CLIP-seq
MIRT950560	hsa-miR-200a	CLIP-seq
MIRT950562	hsa-miR-216b	CLIP-seq
MIRT950563	hsa-miR-2276	CLIP-seq
MIRT950565	hsa-miR-28-5p	CLIP-seq
MIRT950566	hsa-miR-298	CLIP-seq
MIRT950569	hsa-miR-3139	CLIP-seq
MIRT950573	hsa-miR-3607-3p	CLIP-seq
MIRT950575	hsa-miR-3614-5p	CLIP-seq
MIRT950577	hsa-miR-3622b-5p	CLIP-seq
MIRT950578	hsa-miR-3646	CLIP-seq
MIRT1981542	hsa-miR-4253	CLIP-seq
MIRT950584	hsa-miR-4263	CLIP-seq
MIRT950586	hsa-miR-4326	CLIP-seq
MIRT950591	hsa-miR-4459	CLIP-seq
MIRT950593	hsa-miR-4487	CLIP-seq
MIRT1981549	hsa-miR-451b	CLIP-seq
MIRT950596	hsa-miR-4530	CLIP-seq
MIRT950599	hsa-miR-4640-5p	CLIP-seq
MIRT1981557	hsa-miR-4691-3p	CLIP-seq
MIRT1981558	hsa-miR-4696	CLIP-seq
MIRT950606	hsa-miR-4726-5p	CLIP-seq
MIRT1981564	hsa-miR-4761-3p	CLIP-seq
MIRT950610	hsa-miR-4772-3p	CLIP-seq
MIRT950613	hsa-miR-4799-5p	CLIP-seq
MIRT950619	hsa-miR-576-5p	CLIP-seq
MIRT1981567	hsa-miR-622	CLIP-seq
MIRT950623	hsa-miR-665	CLIP-seq
MIRT950624	hsa-miR-708	CLIP-seq
MIRT2216557	hsa-miR-760	CLIP-seq
MIRT950626	hsa-miR-765	CLIP-seq
MIRT950629	hsa-miR-922	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HCFC1	Repression	17612494
RBL2	Unknown	8575214
TRIM28	Repression	23060449

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	21454377
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10488129
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001216	Function	DNA-binding transcription activator activity	IDA	17062573
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11418595
GO:0002064	Process	Epithelial cell development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	11418595
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11418595
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	11418595, 14532282, 16061792, 16360038, 17062573, 17159899, 17531812, 20133863, 22002537, 22810586, 24981860, 27705803, 32296183, 33961781, 34591612, 34591642, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IDA	17062573
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006884	Process	Cell volume homeostasis	IEA
GO:0008015	Process	Blood circulation	IEA
GO:0008361	Process	Regulation of cell size	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0019904	Function	Protein domain specific binding	IPI	16360038
GO:0030030	Process	Cell projection organization	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0044458	Process	Motile cilium assembly	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11418595
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0060271	Process	Cilium assembly	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0098534	Process	Centriole assembly	ISS
GO:1903251	Process	Multi-ciliated epithelial cell differentiation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IDA	25100735

MIM	HGNC	e!Ensembl
600659	3118	ENSG00000205250

Q16254

Protein name

Transcription factor E2F4 (E2F-4)

Protein function

Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication

PDB

1CF7 , 5TUU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02319	E2F_TDP	18 → 83	E2F/DP family winged-helix DNA-binding domain	Domain
PF16421	E2F_CC-MB	100 → 196	E2F transcription factor CC-MB domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in all tissue examined including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence

MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYD
ITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIELKAEIEELQQREQELDQHKVW
VQQSIRNVTEDVQNSCLAYVTHEDICRCFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQ
IHLKSVSGPIEVLLVNKEAWSSPPVAVPVPPPEDLLQSPSAVSTPPPLPKPALAQSQEAS
RPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ
SSALLDSSSSSSSSSSSSSNSNSSSSSGPNPSTSFEPIKADPTGVLELPKELSEIFDPTR
ECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL

Sequence length

413

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Cellular senescence TGF-beta signaling pathway		Transcription of E2F targets under negative control by DREAM complex G0 and Early G1 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Cyclin E associated events during G1/S transition G1/S-Specific Transcription Cyclin D associated events in G1 Cyclin A:Cdk2-associated events at S phase entry

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LYNCH SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (79)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	28657656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11012981, 9192806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	12373148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29754146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17089045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	23919615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10666234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	26498477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	26498477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	9780003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26032289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33381564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11759817, 12789259, 15221934, 22037783, 23007606, 23015403, 25440089, 26199016, 28464832, 29805583, 31010740, 31557971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23015403, 25440089, 28464832, 29581135, 31557971, 35140308, 35838496, 37700392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	22475873, 30127896		★★★★★ ★☆☆☆☆ Found in Text Mining only
CADASIL	Cadasil	Pubtator	33767277	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17121828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10496529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24574752, 29658607, 31737652, 39239750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26032289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30970615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10666234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	28675157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	11468517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33767277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11025371, 12373148, 19562678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	10601558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12148576, 24100580, 8878551, 9485005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12148576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12373148, 24100580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19585502, 28628609, 29505855, 30658502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	9777938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23167388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30970615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25712098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	9192806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37567906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33381564, 37349788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10666234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	10666234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	34807923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21670155	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	25801299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	29328431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	29328431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10666234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10666234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	11025371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	11025371		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	26856934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	26856934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16216419, 16317707, 29658607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10797289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12789259, 15221934, 22037783, 23007606, 23015403, 25440089, 26199016, 28464832, 29581135, 29805583, 31010740, 31557971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11358857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26032289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10797289, 11025371, 11439366, 23015403, 25440089, 27991932, 28675157, 30047092, 9713355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11025371, 12373148, 19562678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29805583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10727462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	10585280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21152067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	9485005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10213220, 10717241, 10982822, 11358857, 11439366, 11468517, 12373148, 15221934, 15609312, 17106239, 17200349, 22475873, 23745020, 25440089, 29581135, 29805583, 9192806, 9485005, 9824204 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23167388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	22733545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34799547, 37506248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15118916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25432544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11358857, 17043659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	39473405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30841904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10982822, 12352662, 30166342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25712098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11012981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26152289, 36855110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25646628, 30487158, 35253629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	9192806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35262965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

E2F4 (E2F transcription factor 4)