APLNR (apelin receptor)

Gene

• Entrez ID: 187
• Gene name: Apelin receptor
• Gene symbol: APLNR
• Synonyms (NCBI Gene): AGTRL1, APJ, APJR, HG11
• Chromosome: 11
• Chromosome location: 11q12.1
• Summary: This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051137	hsa-miR-16-5p	CLASH	23622248
MIRT047418	hsa-miR-10b-5p	CLASH	23622248
MIRT732441	hsa-miR-483-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33436040
MIRT734203	hsa-miR-424-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	32774725
MIRT734203	hsa-miR-424-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	32774725
MIRT734203	hsa-miR-424-5p	ELISA, Western blotting, Luciferase reporter assay, qRT-PCR	32774725
MIRT789578	hsa-miR-1224-5p	CLIP-seq
MIRT789579	hsa-miR-1236	CLIP-seq
MIRT789580	hsa-miR-1251	CLIP-seq
MIRT789581	hsa-miR-1285	CLIP-seq
MIRT789582	hsa-miR-1304	CLIP-seq
MIRT789583	hsa-miR-145	CLIP-seq
MIRT789584	hsa-miR-1825	CLIP-seq
MIRT789585	hsa-miR-199a-5p	CLIP-seq
MIRT789586	hsa-miR-199b-5p	CLIP-seq
MIRT789587	hsa-miR-2110	CLIP-seq
MIRT789588	hsa-miR-3150a-3p	CLIP-seq
MIRT789589	hsa-miR-3157-3p	CLIP-seq
MIRT789590	hsa-miR-3175	CLIP-seq
MIRT789591	hsa-miR-3187-5p	CLIP-seq
MIRT789592	hsa-miR-326	CLIP-seq
MIRT789593	hsa-miR-330-5p	CLIP-seq
MIRT789594	hsa-miR-378g	CLIP-seq
MIRT789595	hsa-miR-3915	CLIP-seq
MIRT789596	hsa-miR-4255	CLIP-seq
MIRT789597	hsa-miR-4260	CLIP-seq
MIRT789598	hsa-miR-4286	CLIP-seq
MIRT789599	hsa-miR-4426	CLIP-seq
MIRT789600	hsa-miR-4486	CLIP-seq
MIRT789601	hsa-miR-4647	CLIP-seq
MIRT789602	hsa-miR-4662b	CLIP-seq
MIRT789603	hsa-miR-4677-3p	CLIP-seq
MIRT789604	hsa-miR-4679	CLIP-seq
MIRT789605	hsa-miR-4689	CLIP-seq
MIRT789606	hsa-miR-4728-5p	CLIP-seq
MIRT789607	hsa-miR-4751	CLIP-seq
MIRT789608	hsa-miR-4777-5p	CLIP-seq
MIRT789609	hsa-miR-518d-5p	CLIP-seq
MIRT789610	hsa-miR-519b-5p	CLIP-seq
MIRT789611	hsa-miR-519c-5p	CLIP-seq
MIRT789612	hsa-miR-520c-5p	CLIP-seq
MIRT789613	hsa-miR-526a	CLIP-seq
MIRT789614	hsa-miR-612	CLIP-seq
MIRT789615	hsa-miR-874	CLIP-seq
MIRT789616	hsa-miR-938	CLIP-seq
MIRT789617	hsa-miR-939	CLIP-seq
MIRT1932930	hsa-miR-3182	CLIP-seq
MIRT1932931	hsa-miR-4690-3p	CLIP-seq
MIRT2173078	hsa-miR-4786-3p	CLIP-seq
MIRT2173079	hsa-miR-922	CLIP-seq
MIRT2675147	hsa-miR-214	CLIP-seq
MIRT2675148	hsa-miR-3619-5p	CLIP-seq
MIRT2675149	hsa-miR-4514	CLIP-seq
MIRT2675150	hsa-miR-4690-5p	CLIP-seq
MIRT2675151	hsa-miR-4692	CLIP-seq
MIRT2675152	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Activation	17309882

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001568	Process	Blood vessel development	IBA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0001944	Process	Vasculature development	IEA
GO:0001944	Process	Vasculature development	ISS
GO:0001947	Process	Heart looping	IEA
GO:0001947	Process	Heart looping	ISS
GO:0002031	Process	G protein-coupled receptor internalization	IDA	10644702
GO:0002031	Process	G protein-coupled receptor internalization	IMP	12582207
GO:0003171	Process	Atrioventricular valve development	IEA
GO:0003171	Process	Atrioventricular valve development	ISS
GO:0003272	Process	Endocardial cushion formation	IEA
GO:0003272	Process	Endocardial cushion formation	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8294032
GO:0005515	Function	Protein binding	IPI	21412239, 22200678, 22935142, 31668922, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25639753, 35817871, 38428423
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8294032, 9792798
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	35817871
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	25639753
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9792798
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	35817871, 38428423
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	ISS
GO:0007512	Process	Adult heart development	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IDA	35817871
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010468	Process	Regulation of gene expression	ISS
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IC	10644702, 12582207
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0016020	Component	Membrane	IEA
GO:0035886	Process	Vascular associated smooth muscle cell differentiation	IEA
GO:0035886	Process	Vascular associated smooth muscle cell differentiation	ISS
GO:0035904	Process	Aorta development	IEA
GO:0035904	Process	Aorta development	ISS
GO:0038023	Function	Signaling receptor activity	TAS	9792798
GO:0043951	Process	Negative regulation of cAMP-mediated signaling	IBA
GO:0043951	Process	Negative regulation of cAMP-mediated signaling	IMP	25639753
GO:0045766	Process	Positive regulation of angiogenesis	IMP	25639753
GO:0050878	Process	Regulation of body fluid levels	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IMP	25639753
GO:0060182	Function	Apelin receptor activity	IBA
GO:0060182	Function	Apelin receptor activity	IDA	22810587, 38428423
GO:0060182	Function	Apelin receptor activity	IEA
GO:0060182	Function	Apelin receptor activity	IMP	38428423
GO:0060183	Process	Apelin receptor signaling pathway	IDA	22810587, 38428423
GO:0060183	Process	Apelin receptor signaling pathway	IEA
GO:0060183	Process	Apelin receptor signaling pathway	IMP	38428423
GO:0060183	Process	Apelin receptor signaling pathway	ISS
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060841	Process	Venous blood vessel development	IEA
GO:0060841	Process	Venous blood vessel development	ISS
GO:0060976	Process	Coronary vasculature development	IEA
GO:0060976	Process	Coronary vasculature development	ISS
GO:0140897	Function	Mechanoreceptor activity	IDA	22810587
GO:0140897	Function	Mechanoreceptor activity	IEA
GO:1903243	Process	Negative regulation of cardiac muscle hypertrophy in response to stress	ISS	22810587
GO:1903244	Process	Positive regulation of cardiac muscle hypertrophy in response to stress	ISS
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IEA
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	ISS
GO:1903596	Process	Regulation of gap junction assembly	IEA
GO:1903596	Process	Regulation of gap junction assembly	ISS
GO:1904022	Process	Positive regulation of G protein-coupled receptor internalization	IMP	25639753

Other IDs

• MIM: 600052
• HGNC: 339
• e!Ensembl: ENSG00000134817

Protein

• UniProt ID: P35414
• Protein name: Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11)
• Protein function: G protein-coupled receptor for peptide hormones apelin (APLN) and apelin receptor early endogenous ligand (APELA/ELA), that plays a role in the regulation of normal cardiovascular function and fluid homeostasis (PubMed:11090199, PubMed:22810587,
• PDB: 2LOT, 2LOU, 2LOV, 2LOW, 5VBL, 6KNM, 7SUS, 7W0L, 7W0M, 7W0N, 7W0O, 7W0P, 8XQE, 8XQF, 8XQI, 8XQJ, 8XZF, 8XZG, 8XZH, 8XZI, 8XZJ, 8Z74, 8Z7J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	45 → 309	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, brain, kidney, stomach, spleen, thymus, lung, ovary, small intestine and colon, adipose tissues and pancreas (PubMed:25639753, PubMed:8294032). Expressed in glial cells, astrocytes and neuronal subpopulations (PubMe
• Sequence:

  MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK
  RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL
  TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ
  CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL
  RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV
  NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK
  GGEQMHEKSIPYSQETLVVD

• Sequence length: 380

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Apelin signaling pathway

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	34443478	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	19680269, 25438973, 27825851, 29691838		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19680269, 25438973, 27825851, 29691838		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20649580	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	25438973, 30278567, 30518720		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	30518720	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	17309882		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	LHGDN	17309882		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17412318		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	17412318		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30783205	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30858172		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28728608	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	20649580	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	17826642		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20649580	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24990699, 25438973, 26102594, 27825851, 28091541, 29245958, 30459635, 30634441, 31101543		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19680269, 29296197		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	27894959		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29215755		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30783205		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31547096		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27894959		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	25184296		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12914775, 17826642, 17906101, 25184296, 25438973, 25993436, 27033703, 28091541, 28371822, 29775410, 30901161, 31101543, 31645268, 31724863		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30783205		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19680269, 22109355, 23226564, 25184296, 25993436, 27854125, 28915675, 29883719		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19680269, 22109355, 23226564, 25438973, 25993436, 28915675, 29883719		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23226564, 25993436	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19680269, 22109355, 23226564, 25993436, 28915675, 29883719		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20652246		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29432881		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20055692, 27650065		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20055692, 27650065		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20233941, 23577111		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23577111, 29522374		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	40165344	Associate	★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	20220056		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30640413	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	19307984, 20485192, 27450650		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31653030		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28087150		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29053791, 30718358		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36193059	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29053791, 30718358		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17412318		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20649580, 36239923	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27854125		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12914775, 17826642, 17906101, 25184296, 25438973, 25993436, 27033703, 28091541, 28371822, 29775410, 30901161, 31101543, 31645268, 31724863		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	20649580, 25993436, 36239923	Associate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	30518720		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	35501731	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33255902	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23226564, 24465893, 27338090, 27863393	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19307984, 20485192, 21233449, 22109355, 23226564, 24465893, 24990699, 25438973, 27338090, 27450650, 27863393, 27903222, 28945940, 28987634, 29800734, 29883719, 30070701, 30459635, 30582943, 30627376, 31116039		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	21654856	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25438973, 28137936, 30710493, 30901161		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10802050		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32271399	Inhibit	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28167898, 28648959		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	20055692		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25275024, 31177144		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	33436040	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	24962866		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30640413	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17412318		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30858172		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30640413, 30783205, 30858172, 30920988, 31264472		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28051763		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36224027	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29432881		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25438973, 30570369		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31217908		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28065733		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28614788		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	25184296, 27854125, 30070701		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	25993436	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31408612		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22037214, 25275024, 27894959, 28514205, 29053791, 30640413, 30783205, 30858172, 30920988, 31547096		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20233941, 23429279, 27834140, 31472173		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23438363	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20652246	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30920988		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30858172		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30736903		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	39273568	Associate	★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	20220056		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	36591713	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36591713	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28137936, 28407045, 30710493, 30901161		★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	25918383	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Veno-Occlusive Disease (disorder)	Pulmonary venoocclusive disease	BEFREE	25062690		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30783205		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29118394		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	33743591	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	30327649	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30640413		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31791369		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30327649		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	30518720	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29215755, 31738185		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	25993436	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	25993436	Associate	★☆☆☆☆ Found in Text Mining only