E2F1 (E2F transcription factor 1)

Gene

• Entrez ID: 1869
• Gene name: E2F transcription factor 1
• Gene symbol: E2F1
• Synonyms (NCBI Gene): E2F-1, RBAP1, RBBP3, RBP3
• Chromosome: 20
• Chromosome location: 20q11.22
• Summary: The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DN

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay	18676839
MIRT003045	hsa-miR-106b-5p	qRT-PCR	18676839
MIRT001191	hsa-miR-21-5p	qRT-PCR, Western blot	19906824
MIRT001124	hsa-miR-98-5p	Luciferase reporter assay	19528081
MIRT001191	hsa-miR-21-5p	Luciferase reporter assay	19528081
MIRT000718	hsa-miR-330-3p	Luciferase reporter assay, Western blot	19597470
MIRT000718	hsa-miR-330-3p	Luciferase reporter assay, Western blot	19597470
MIRT000632	hsa-miR-223-3p	Luciferase reporter assay, Western blot	20029046
MIRT000632	hsa-miR-223-3p	Luciferase reporter assay, Western blot	20029046
MIRT000718	hsa-miR-330-3p	Luciferase reporter assay	19597470
MIRT003045	hsa-miR-106b-5p	Review	19815577
MIRT002472	hsa-miR-93-5p	Review	19815577
MIRT003424	hsa-miR-23b-3p	flow, Microarray	20133741
MIRT003322	hsa-miR-205-5p	Review	20026422
MIRT000374	hsa-miR-106a-5p	Immunohistochemistry, Microarray, Western blot	20643754
MIRT004821	hsa-miR-34a-5p	Immunoblot, Immunohistochemistry, qRT-PCR	17875987
MIRT002935	hsa-miR-17-5p	qRT-PCR	18521848
MIRT000374	hsa-miR-106a-5p	qRT-PCR	18521848
MIRT005020	hsa-miR-126-3p	qRT-PCR	18521848
MIRT000180	hsa-miR-20a-5p	Western blot	18836483
MIRT002935	hsa-miR-17-5p	Western blot	18836483
MIRT005356	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005356	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay, Northern blot, Western blot	15944709
MIRT002935	hsa-miR-17-5p	Northern blot, qRT-PCR, Western blot	16940181
MIRT000180	hsa-miR-20a-5p	Western blot	19110058
MIRT003904	hsa-let-7a-5p	Western blot	19110058
MIRT000180	hsa-miR-20a-5p	Western blot	18025036
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	19486339
MIRT002472	hsa-miR-93-5p	Luciferase reporter assay, Western blot	19486339
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay, Microarray, Western blot	18328430
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay, Microarray, Western blot	18328430
MIRT002472	hsa-miR-93-5p	Luciferase reporter assay, Microarray, Western blot	18328430
MIRT002472	hsa-miR-93-5p	Luciferase reporter assay, Microarray, Western blot	18328430
MIRT002935	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT006039	hsa-miR-203a-3p	Immunoblot, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21159887
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT006039	hsa-miR-203a-3p	Immunoblot, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21159887
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT006506	hsa-miR-331-3p	Luciferase reporter assay, Western blot	20510161
MIRT006506	hsa-miR-331-3p	Luciferase reporter assay, Western blot	20510161
MIRT006039	hsa-miR-203a-3p	Immunoblot, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21159887
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	21656380
MIRT006506	hsa-miR-331-3p	Luciferase reporter assay, Western blot	20510161
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	22578566
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	22578566
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	22578566
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT007349	hsa-miR-362-3p	Western blot	23280316
MIRT016529	hsa-miR-193b-3p	Microarray	20304954
MIRT020292	hsa-miR-130b-3p	Sequencing	20371350
MIRT003045	hsa-miR-106b-5p	Reporter assay	18212054
MIRT005356	hsa-miR-149-3p	Reporter assay;Western blot;qRT-PCR;Other	20623644
MIRT003322	hsa-miR-205-5p	Reporter assay	21454583
MIRT004821	hsa-miR-34a-5p	Western blot	21128241
MIRT002472	hsa-miR-93-5p	Sequencing	20371350
MIRT030626	hsa-miR-24-3p	qRT-PCR	19748357
MIRT000180	hsa-miR-20a-5p	Reporter assay	15944709
MIRT002935	hsa-miR-17-5p	Reporter assay	15944709
MIRT035553	hsa-miR-181b-5p	Luciferase reporter assay, Western blot	23083446
MIRT035553	hsa-miR-181b-5p	Luciferase reporter assay, Western blot	23083446
MIRT047521	hsa-miR-10a-5p	CLASH	23622248
MIRT035553	hsa-miR-181b-5p	CLASH	23622248
MIRT000180	hsa-miR-20a-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23868977
MIRT002935	hsa-miR-17-5p	qRT-PCR	24901013
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, Western blot	23629002
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, Western blot	23629002
MIRT003322	hsa-miR-205-5p	Luciferase reporter assay, Western blot	23629002
MIRT438107	hsa-miR-329-3p	Luciferase reporter assay	23866847
MIRT438107	hsa-miR-329-3p	Luciferase reporter assay	23866847
MIRT438107	hsa-miR-329-3p	Luciferase reporter assay	23866847
MIRT438107	hsa-miR-329-3p	Luciferase reporter assay	23866847
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	20371350
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	20371350
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	20371350
MIRT083347	hsa-miR-4283	PAR-CLIP	20371350
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	20371350
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	20371350
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT511995	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	23446348
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	23446348
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	23446348
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT083347	hsa-miR-4283	PAR-CLIP	23446348
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	23446348
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	23446348
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT511995	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	23446348
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	23446348
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	23446348
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT083347	hsa-miR-4283	PAR-CLIP	23446348
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	23446348
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	23446348
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT003045	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT000180	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT003045	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT002935	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727824	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT002472	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727823	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT000180	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT004821	hsa-miR-34a-5p	qRT-PCR, Western blot	27704360
MIRT004821	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28293146
MIRT004821	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28293146
MIRT727823	hsa-miR-519d-3p	Luciferase reporter assay	28146423
MIRT000180	hsa-miR-20a-5p	Luciferase reporter assay	27282946
MIRT000374	hsa-miR-106a-3p	RNA-seq	33037409
MIRT000374	hsa-miR-106a-3p	RNA-seq	33037409
MIRT000374	hsa-miR-106a-5p	RNA-seq	33037409
MIRT000374	hsa-miR-106a-5p	RNA-seq	33037409
MIRT003045	hsa-miR-106b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33495833
MIRT727824	hsa-miR-20b-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32174776
MIRT000374	hsa-miR-106a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32174776
MIRT000718	hsa-miR-330-3p	qRT-PCR	32884568
MIRT737286	hsa-miR-92a-3p	Western blotting	32917956
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	20371350
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	20371350
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	20371350
MIRT083347	hsa-miR-4283	PAR-CLIP	20371350
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	20371350
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	20371350
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT511995	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	23446348
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	23446348
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	23446348
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT083347	hsa-miR-4283	PAR-CLIP	23446348
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	23446348
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	23446348
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT511997	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT511996	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT511994	hsa-miR-6805-5p	PAR-CLIP	23446348
MIRT511995	hsa-miR-211-3p	PAR-CLIP	23446348
MIRT511993	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT083388	hsa-miR-7113-5p	PAR-CLIP	23446348
MIRT083373	hsa-miR-4685-5p	PAR-CLIP	23446348
MIRT083385	hsa-miR-6837-5p	PAR-CLIP	23446348
MIRT153017	hsa-miR-3158-5p	PAR-CLIP	23446348
MIRT511992	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT511991	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT083347	hsa-miR-4283	PAR-CLIP	23446348
MIRT083357	hsa-miR-6846-5p	PAR-CLIP	23446348
MIRT083358	hsa-miR-6848-5p	PAR-CLIP	23446348
MIRT511990	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT755490	hsa-miR-1205	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	35994229
MIRT755768	hsa-miR-183-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35655310
MIRT003322	hsa-miR-205-5p	Microarray, qRT-PCR	35816043
MIRT950078	hsa-miR-1299	CLIP-seq
MIRT950079	hsa-miR-136	CLIP-seq
MIRT950080	hsa-miR-1976	CLIP-seq
MIRT950081	hsa-miR-2278	CLIP-seq
MIRT950082	hsa-miR-2355-5p	CLIP-seq
MIRT950083	hsa-miR-3138	CLIP-seq
MIRT950084	hsa-miR-3150b-3p	CLIP-seq
MIRT950085	hsa-miR-3151	CLIP-seq
MIRT950086	hsa-miR-3192	CLIP-seq
MIRT950087	hsa-miR-320a	CLIP-seq
MIRT950088	hsa-miR-320b	CLIP-seq
MIRT950089	hsa-miR-320c	CLIP-seq
MIRT950090	hsa-miR-320d	CLIP-seq
MIRT950091	hsa-miR-329	CLIP-seq
MIRT950092	hsa-miR-3679-3p	CLIP-seq
MIRT950093	hsa-miR-3689a-3p	CLIP-seq
MIRT950094	hsa-miR-3689c	CLIP-seq
MIRT950095	hsa-miR-3929	CLIP-seq
MIRT950096	hsa-miR-3941	CLIP-seq
MIRT950097	hsa-miR-3945	CLIP-seq
MIRT950098	hsa-miR-4253	CLIP-seq
MIRT950099	hsa-miR-4276	CLIP-seq
MIRT950100	hsa-miR-4419b	CLIP-seq
MIRT950101	hsa-miR-4429	CLIP-seq
MIRT950102	hsa-miR-4434	CLIP-seq
MIRT950103	hsa-miR-4438	CLIP-seq
MIRT950104	hsa-miR-4478	CLIP-seq
MIRT950105	hsa-miR-4491	CLIP-seq
MIRT950106	hsa-miR-4505	CLIP-seq
MIRT950107	hsa-miR-4516	CLIP-seq
MIRT950108	hsa-miR-4519	CLIP-seq
MIRT950109	hsa-miR-4531	CLIP-seq
MIRT950110	hsa-miR-4643	CLIP-seq
MIRT950111	hsa-miR-4657	CLIP-seq
MIRT950112	hsa-miR-4667-3p	CLIP-seq
MIRT950113	hsa-miR-4705	CLIP-seq
MIRT950114	hsa-miR-4722-3p	CLIP-seq
MIRT950115	hsa-miR-4728-5p	CLIP-seq
MIRT950116	hsa-miR-4782-5p	CLIP-seq
MIRT950117	hsa-miR-4784	CLIP-seq
MIRT950118	hsa-miR-4800-5p	CLIP-seq
MIRT950119	hsa-miR-486-3p	CLIP-seq
MIRT950120	hsa-miR-491-5p	CLIP-seq
MIRT950121	hsa-miR-493	CLIP-seq
MIRT950122	hsa-miR-516b	CLIP-seq
MIRT950123	hsa-miR-548ac	CLIP-seq
MIRT950124	hsa-miR-548d-3p	CLIP-seq
MIRT950125	hsa-miR-548z	CLIP-seq
MIRT950126	hsa-miR-603	CLIP-seq
MIRT950127	hsa-miR-885-5p	CLIP-seq
MIRT950128	hsa-miR-939	CLIP-seq
MIRT1981433	hsa-miR-106a	CLIP-seq
MIRT1981434	hsa-miR-106b	CLIP-seq
MIRT1981435	hsa-miR-1258	CLIP-seq
MIRT1981436	hsa-miR-17	CLIP-seq
MIRT1981437	hsa-miR-20a	CLIP-seq
MIRT1981438	hsa-miR-20b	CLIP-seq
MIRT950081	hsa-miR-2278	CLIP-seq
MIRT1981439	hsa-miR-3973	CLIP-seq
MIRT1981440	hsa-miR-4418	CLIP-seq
MIRT1981441	hsa-miR-4459	CLIP-seq
MIRT1981442	hsa-miR-4476	CLIP-seq
MIRT950108	hsa-miR-4519	CLIP-seq
MIRT1981443	hsa-miR-4722-5p	CLIP-seq
MIRT1981444	hsa-miR-4779	CLIP-seq
MIRT950120	hsa-miR-491-5p	CLIP-seq
MIRT1981445	hsa-miR-509-3-5p	CLIP-seq
MIRT1981446	hsa-miR-509-5p	CLIP-seq
MIRT1981447	hsa-miR-519a	CLIP-seq
MIRT1981448	hsa-miR-519b-3p	CLIP-seq
MIRT1981449	hsa-miR-519c-3p	CLIP-seq
MIRT1981450	hsa-miR-519d	CLIP-seq
MIRT1981451	hsa-miR-520g	CLIP-seq
MIRT1981452	hsa-miR-520h	CLIP-seq
MIRT1981453	hsa-miR-93	CLIP-seq
MIRT950128	hsa-miR-939	CLIP-seq
MIRT1981433	hsa-miR-106a	CLIP-seq
MIRT1981434	hsa-miR-106b	CLIP-seq
MIRT1981436	hsa-miR-17	CLIP-seq
MIRT2216457	hsa-miR-181a	CLIP-seq
MIRT2216458	hsa-miR-181b	CLIP-seq
MIRT2216459	hsa-miR-181c	CLIP-seq
MIRT2216460	hsa-miR-181d	CLIP-seq
MIRT1981437	hsa-miR-20a	CLIP-seq
MIRT1981438	hsa-miR-20b	CLIP-seq
MIRT2216461	hsa-miR-3649	CLIP-seq
MIRT2216462	hsa-miR-377	CLIP-seq
MIRT2216463	hsa-miR-4262	CLIP-seq
MIRT950110	hsa-miR-4643	CLIP-seq
MIRT1981447	hsa-miR-519a	CLIP-seq
MIRT1981448	hsa-miR-519b-3p	CLIP-seq
MIRT1981449	hsa-miR-519c-3p	CLIP-seq
MIRT1981450	hsa-miR-519d	CLIP-seq
MIRT950126	hsa-miR-603	CLIP-seq
MIRT1981453	hsa-miR-93	CLIP-seq
MIRT950091	hsa-miR-329	CLIP-seq
MIRT950110	hsa-miR-4643	CLIP-seq
MIRT950126	hsa-miR-603	CLIP-seq
MIRT1981433	hsa-miR-106a	CLIP-seq
MIRT1981434	hsa-miR-106b	CLIP-seq
MIRT1981436	hsa-miR-17	CLIP-seq
MIRT1981437	hsa-miR-20a	CLIP-seq
MIRT1981438	hsa-miR-20b	CLIP-seq
MIRT950085	hsa-miR-3151	CLIP-seq
MIRT2448628	hsa-miR-3154	CLIP-seq
MIRT1981439	hsa-miR-3973	CLIP-seq
MIRT2448629	hsa-miR-4270	CLIP-seq
MIRT950102	hsa-miR-4434	CLIP-seq
MIRT2448630	hsa-miR-4441	CLIP-seq
MIRT2448631	hsa-miR-4443	CLIP-seq
MIRT950107	hsa-miR-4516	CLIP-seq
MIRT1981447	hsa-miR-519a	CLIP-seq
MIRT1981448	hsa-miR-519b-3p	CLIP-seq
MIRT1981449	hsa-miR-519c-3p	CLIP-seq
MIRT1981450	hsa-miR-519d	CLIP-seq
MIRT1981451	hsa-miR-520g	CLIP-seq
MIRT1981452	hsa-miR-520h	CLIP-seq
MIRT2448632	hsa-miR-564	CLIP-seq
MIRT1981453	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARID3A	Unknown	23659165
E2F1	Unknown	7958836
E2F6	Repression	18562691
E2F7	Repression	18202719
E2F8	Repression	18202719
ELL	Repression	24344198
ERCC2	Unknown	9400991
ESR1	Unknown	10446910;12697671
HCFC1	Activation	17612494;19763085
HDAC1	Repression	9724731
HES1	Repression	15467735
HIC1	Repression	19486893
IRF1	Repression	22200613
NFKB1	Unknown	16725311
NR0B2	Repression	18657049
NR2F2	Unknown	22734039
NR4A1	Activation	12947120
PA2G4	Repression	16254079
PA2G4	Unknown	17786317
PARP1	Activation	14627987
PAX8	Activation	21602887
PGR	Activation	20123965
POLR1A	Repression	21878508
RB1	Repression	12460790;1534305;21602887;9326598;9400991;9671466
RB1	Unknown	11939591;8575214
RELA	Unknown	16725311
RORA	Unknown	24891616
SIN3A	Repression	16254079
SP1	Unknown	10446910
TBP	Unknown	9400991
TFDP3	Unknown	23212661
TP53	Repression	8557038
TP73	Unknown	19363520
TRIM16	Repression	20729920
YBX1	Unknown	22205655

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IMP	12717439
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20224733
GO:0000228	Component	Nuclear chromosome	IEA
GO:0000785	Component	Chromatin	IDA	21454377
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	20040599
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	15735762
GO:0001216	Function	DNA-binding transcription activator activity	IDA	17062573, 28992046
GO:0001216	Function	DNA-binding transcription activator activity	IEA
GO:0003677	Function	DNA binding	IDA	15073182, 15731768
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	11418595
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15731768
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	11418595
GO:0005515	Function	Protein binding	IPI	7784053, 8336704, 8657141, 9418871, 9468139, 9468140, 11418595, 11486038, 12502741, 14627987, 16061792, 16249186, 16360038, 16374512, 16892051, 17006541, 17062573, 17380128, 17517653, 17690688, 17704056, 18660514, 18660752, 18794899, 19188449, 19249677, 20040599, 20133863, 20195357
GO:0005634	Component	Nucleus	IDA	28992046
GO:0005634	Component	Nucleus	IDA	1531329, 12717439, 20040599
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006351	Process	DNA-templated transcription	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	1531329, 12717439, 23934193
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IMP	12717439
GO:0010628	Process	Positive regulation of gene expression	IDA	15766563
GO:0019901	Function	Protein kinase binding	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032991	Component	Protein-containing complex	IDA	23629655
GO:0035189	Component	Rb-E2F complex	IBA
GO:0035189	Component	Rb-E2F complex	IDA	20224733
GO:0035189	Component	Rb-E2F complex	IPI	16360038
GO:0043065	Process	Positive regulation of apoptotic process	IDA	15565177
GO:0043276	Process	Anoikis	IEA
GO:0043392	Process	Negative regulation of DNA binding	IDA	20176812
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20176812
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	21454377, 22476863
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	15565177
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	28992046
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20040599, 20224733
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	20224733
GO:0048255	Process	MRNA stabilization	IDA	15766563
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	16360038
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0070345	Process	Negative regulation of fat cell proliferation	IEA
GO:0070345	Process	Negative regulation of fat cell proliferation	ISS
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	16360038
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16360038, 20176812
GO:1990086	Process	Lens fiber cell apoptotic process	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IMP	20224733

Other IDs

• MIM: 189971
• HGNC: 3113
• e!Ensembl: ENSG00000101412

Protein

• UniProt ID: Q01094
• Protein name: Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1)
• Protein function: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication
• PDB: 1H24, 1O9K, 2AZE, 5M9N, 5M9O, 6G0P, 6ULS, 9CB3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02319	E2F_TDP	128 → 192	E2F/DP family winged-helix DNA-binding domain	Domain
  PF16421	E2F_CC-MB	206 → 299	E2F transcription factor CC-MB domain	Domain

• Sequence:

  MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
  PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
  SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
  AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
  QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
  ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
  RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
  IRDLFDCDFGDLTPLDF

• Sequence length: 437

Pathways

KEGG:

Endocrine resistance
Cell cycle
Mitophagy - animal
Cellular senescence
Cushing syndrome
Hepatitis C
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
MicroRNAs in cancer
Chemical carcinogenesis - receptor activation
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

Activation of NOXA and translocation to mitochondria
Transcription of E2F targets under negative control by DREAM complex
Activation of PUMA and translocation to mitochondria
Pre-NOTCH Transcription and Translation
Oxidative Stress Induced Senescence
Oncogene Induced Senescence
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
CDC6 association with the ORC:origin complex
G2 Phase
Cyclin E associated events during G1/S transition
G1/S-Specific Transcription
Cyclin D associated events in G1
Cyclin A:Cdk2-associated events at S phase entry
Transcriptional Regulation by E2F6
Transcriptional regulation of granulopoiesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
E2F1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	31828584		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	7774910		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26239033, 29768346		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	24516045		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30914194		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10713684, 15221933, 23745020		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15517914, 16052233		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30362161		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	23745020		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16052233, 24341432, 24691991, 25174355, 31071530, 31194977		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	31363169		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26239033, 29768346		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	10803523		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	24038073		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17483310		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31363169		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	15098008		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11939591	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26086249		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	12598317	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15118916		★☆☆☆☆ Found in Text Mining only
Anemia Dyserythropoietic Congenital	Congenital dyserythropoietic anemia	Pubtator	19336738	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27573434, 29344285		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31363169		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28042322		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	28042322	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	LHGDN	18235226		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	33980953, 37345209	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22240023	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	25523945	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrophy of testis	Testicular atrophy	BEFREE	15531911, 9674698		★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	25439843		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27498834, 29235459, 30964110		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	29464002		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31547405		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10340908, 10696248, 20421545, 25955758, 26268246, 29358577, 29445134, 30104251, 31287003, 31811115		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	31378570		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	16264179		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17483310		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18093951, 29287594, 29764999	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33381564	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11759817, 15169882, 15221933, 16158053, 17535433, 18172323, 18431487, 18751386, 20043081, 20124470, 20410059, 21518729, 22791811, 23251702, 23306062, 23887673, 24290378, 24330704, 24502362, 25029110, 25136922, 26623722, 26833126, 26902425, 26936396, 27132511, 27156566, 28474358, 28667302, 28944922, 29844824, 30128822, 30181579, 30366988, 31341204		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	14672398		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15169882, 15187102, 17201163, 17535433, 17998543, 18751386, 21411498, 21573702, 22093364, 22629304, 24147022, 24283290, 24290378, 24502362, 25029110, 25064027, 25136922, 26623722, 26662961, 26833126, 27094710, 28667302, 28944922, 29287594, 31278126, 32092817, 32705365, 33388604, 33691613, 34518541, 34693792, 35348268, 35711885, 35757841, 36164372, 36414640, 36774386, 36915230, 37537694, 40183319	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	19022773, 19406837	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23237561	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	30964110		★☆☆☆☆ Found in Text Mining only
Carbamoyl-Phosphate Synthase I Deficiency Disease	Carbamoyl Phosphate Synthase Deficiency	BEFREE	10373543		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10594030, 11937641, 16052233, 17692085, 24870800, 26601052, 27153550, 34564711, 35440604, 36068491, 37453246	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10225440, 10454586, 10779229, 12237873, 15221933, 17641417, 21351083		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	32156290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19491197, 23348237, 24223834, 24574752, 24761865, 26722215, 27779207, 28264467, 30106440, 31783876, 32104698, 33541355, 34616498, 35178834, 35402624, 35448958, 35844791, 36721155, 36973424, 37006050, 37531206, 39333873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	32156290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	26349752	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10340908, 10696248, 25955758, 26268246, 29358577, 29445134, 30104251, 31287003, 31811115		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12876208, 19641316, 23271813, 23276293, 24037421, 26483346, 29108454, 29754146, 30036075, 31692554		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17692085, 28667302, 36994850	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37929351	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30951404, 32249812	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	26349752	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	30918106	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12754218, 16126868, 19223542, 22629454, 27655285, 36016851	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26349752	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15059898, 17692085, 22798430, 23637916, 26243836, 28146423, 28667302, 30967995		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24335178, 28559983, 29690802, 29790665, 30696738		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24335178, 28559983, 29452167, 29690802, 29790665, 30696738		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26239033, 29768346		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	24038073		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17483310		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30876691		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	31637886		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	18556456	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21367750, 23054209, 28302063		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	24619556		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	23776525	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10914714, 11705881, 12373148, 12677090, 12679318, 14726656, 15221933, 22241525, 28293146, 31534120		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12679318		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15517914	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10225440, 12084458, 12637937, 12943814, 14679120, 14726656, 23280316, 26093293, 26704889, 27793841, 28189855, 28293146, 28704519, 29203250, 29353348, 30127965, 30131854, 30226575, 31477839		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12677090, 15517914, 18794899, 19585502, 22241525, 24465681, 26637399, 26831819, 28704519, 29794421, 31951832, 34077002, 34175590, 35098394, 35440604, 36221072, 36596519, 37705049, 38062013	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30206933		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23744542, 24023875, 27780824, 29214011, 30348808, 30951404		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	30659775		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	30659775	Associate	★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	27935805		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	14618416		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	18503552		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27802335		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	17011204		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	17011204		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30365982		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29526568		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29526568		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32041280, 36231008	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29526568		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	17566113		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23902294, 36329882	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23902294		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10803523, 30964110		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11423103		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	18366791		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33754208, 35682908, 36454788	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	31445158	Stimulate	★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	31445158		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17692085, 26243836, 28667302		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10778992, 10914734, 25216463, 26475334		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10778992, 10914734, 25216463, 26475334		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32851080, 33436941	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16126868, 23280018, 35662041	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	18438432, 26928463, 29928579		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	18438432	Stimulate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	26928463	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	18438432, 26928463		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26442469, 29526568		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24619556		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29750576, 9766655		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24619556, 28515357		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	21983636		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	21983636		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	16733203		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16166437, 18438954, 20459531, 20571341		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	26396484	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11909963, 16264179, 16496386, 16628012, 17934890, 21850378, 25738367, 27983535, 28042322, 28423669, 28903422, 29547938, 29764999, 8137237		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23707559, 25738367, 27572852, 27983535, 28042322, 29764999, 35058574, 36213002, 37283490	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11909963, 16264179, 16496386, 16628012, 17934890, 21850378, 23707559, 25738367, 27983535, 28042322, 28423669, 28903422, 29547938, 29764999, 8137237		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11445852, 21656380, 25139024, 27835866, 28042322, 29685003, 30366080, 30590814, 9623977, 9864390		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16264179		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23866847, 27835866, 28042322, 28467792, 29424887, 30887657, 33381564, 33542204, 34341417, 34937497, 35615996, 37283490	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	15208647	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	15208647	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11085515, 30036075		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22344756, 23028047	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18431487, 22759382	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	28829944		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	21844226		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28515357		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29526568		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29526568		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	12754218	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30571557		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21738823		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21738823		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	21454803, 23902294	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21454803	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24627085, 25816777, 31834445, 37078361	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27362652, 30841487		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	27362652, 32596346	Associate	★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	31445158		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	30659775	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	30659775	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	17630509		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	23744542		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37310408	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31801947		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	29642801	Stimulate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	19906824		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	19906824, 32518213, 35502531	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28721074, 29050203, 7774910		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31378570	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20889924, 21643017, 29631596	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	34042274	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20029046, 20889924, 21367750, 24516045		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	22341444		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	26856934		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	26856934	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	29980789		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11526499, 14604889, 14618416, 15565109, 16865284, 18535617, 18722373, 19491197, 21419759, 21480327, 21831731, 22911364, 23212661, 23348237, 23435877, 23583198, 23745020, 23868976, 24038073, 24223834, 24440307, 24761865, 25742740, 26510456, 26722215, 27109336, 27175585, 27779207, 28119125, 28134624, 28229942, 28607595, 29048668, 29672926, 29740493, 30106440, 30256916, 30600477, 30906629, 30961699, 31729887, 31783876		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	12029619, 15565109, 28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24619556, 29250171		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	38068980	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11042693, 14604889, 18535617		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	18722373		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	21454803, 32457348	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12876208, 16862215, 17471231, 19887610, 21351083, 22693540, 25105419, 26349752, 26483346, 27009856, 28211871, 29108454, 37060831	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	17471231, 21351083, 23518498		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	24071937		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26175399	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28108556	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23129428, 28108556		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16481740	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27096956, 35711885, 36221072	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	20736344		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10803523, 29661169		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	19406837	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	12607600		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16264179, 21656380		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30036075		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	17483310		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14672398, 15169882, 16158053, 17535433, 18172323, 18431487, 18751386, 20043081, 20124470, 20410059, 22791811, 23251702, 23306062, 23887673, 24290378, 24330704, 24502362, 25029110, 25136922, 26623722, 26833126, 26902425, 26936396, 27132511, 27156566, 27634906, 28474358, 28667302, 28944922, 29844824, 30128822, 30181579, 30366988, 31341204		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	14672398		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10778992, 10914734, 25216463, 26475334		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30254209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23744542		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18722373, 24038073, 26442469, 26510456, 26575952, 31598149, 31783876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12876208, 19641316, 23271813, 23276293, 24037421, 26483346, 29108454, 29754146, 30036075, 31692554		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	29574328		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15059898, 22798430, 23637916, 28146423, 30967995		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11585734, 12065845, 28193232		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11577016, 15221933, 15993550, 16114066, 17178887, 19010821, 19276347, 19597470, 20585447, 20832018, 21106062, 22349817, 23853093, 24239550, 24406621, 24627085, 24742333, 24780839, 25585568, 25816777, 26314905, 26520443, 26659825, 26891801, 28396462, 30100187		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31142321		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17641417, 18328430, 19360313, 20510161, 21869593, 24038122, 24810364, 25593464, 25646628, 26692098, 26867682, 27683111, 28569791, 29330298, 30006956, 30127643, 31115533		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10340908, 10696248, 25955758, 26268246, 29358577, 29445134, 30104251, 31287003, 31811115		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10778992, 11585734, 12237873, 12838312, 16140949, 16498429, 16596252, 17263886, 17488475, 19276347, 19541929, 19833767, 20013022, 20354121, 20675184, 20878133, 21955916, 22389255, 22825328, 23021422, 23377972, 23447575, 23966291, 24014887, 24023875, 24335178, 24809689, 24893334, 24969314, 25216527, 25439843, 26350215, 26475334, 26503019, 26743871, 26902425, 26990556, 27132511, 27573434, 27935805, 28042030, 28134624, 28174209, 28211871, 28474358, 28634044, 28775339, 28880708, 29202480, 29330298, 29654756, 29764999, 29950445, 30206933, 30867845, 30943209, 31124185, 31142321, 31659203, 31831874, 9045954, 9192806		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	29464002		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24335178, 28559983, 29690802, 29790665, 30696738		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10914714, 11705881, 12373148, 12677090, 12679318, 14726656, 15221933, 22241525, 28293146, 31534120		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	14672398		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	14672398		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15169882, 16620391, 17535433, 17550982, 18751386		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26833126, 28775339		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	14672398		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22791882		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17483310		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10570427, 15174900, 15574415, 16481740, 16775429, 16827129, 17263886, 18503552, 19565909, 22871739, 23814494, 25341426, 26024388, 28068326, 29750576, 29990501, 31124185, 31142321		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	10727462, 16481740, 16775429, 16827129, 17263886, 17287612, 21454583, 22871739, 25341426, 31142321, 33745909, 37863326	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	15574415, 16827129		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	16481740, 16775429, 18503552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	30365982		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25335113		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	22629304, 32732304	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24619556		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	16481740, 29743521		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	10585280		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27094710, 31276298	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	31276298		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	18695912		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26225839	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11260083, 28082445, 28789423		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11260083, 14695887, 29969371	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21152067	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	22678059		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	7774910		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10848828, 15481443, 23246221, 7774910		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	12965081		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10848828	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29437554, 31378570, 31819526		★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	11408941		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24531537, 29358228, 31152247		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	29980789		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24218338, 24751144, 35303867	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24751144, 26993269		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	37538797	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	10862017		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10195883, 10214348, 10340908, 10454586, 10570427, 10696248, 10803523, 10914714, 11042693, 11085515, 11381373, 11393276, 11454718, 11577016, 11585734, 11705881, 11961668, 12203362, 12237872, 12237873, 12358350, 12373148, 12637937, 12876208, 14526389, 14612540, 14618416, 14679120, 15044096, 15064745, 15138575, 15221933, 15230729, 15466399, 15763542, 16052233, 16158053, 16166437, 16340309, 16361574, 16498429, 16530485, 16596252, 16766265, 16849574, 16912189, 17001603, 17341621, 17483310, 17488475, 17630509, 17786044, 18042711, 18056168, 18334281, 18431487, 18437686, 18483265, 18519784, 18535617, 18546269, 18751386, 19022773, 19276347, 19360313, 19363520, 19539777, 19541929, 19565909, 19749980, 19783986, 20013022, 20176786, 20196847, 20197383, 20410059, 20522552, 20639906, 20675184, 21245101, 21454377, 21869593, 22139443, 22578566, 22825328, 22890321, 23251702, 23343716, 23377972, 23435877, 23449974, 23518498, 23744542, 23745020, 23792570, 23868976, 24014887, 24023875, 24038122, 24362522, 24632684, 24742333, 25139024, 25174355, 25338120, 25401338, 25466554, 25593464, 25646628, 25714011, 25942479, 26350215, 26510456, 26616862, 26891801, 26993269, 27453342, 27501502, 27626669, 27655285, 27677255, 27793841, 27871087, 28146423, 28293146, 28423601, 28423669, 28474358, 28569791, 28572744, 28704519, 28775339, 28880708, 29048668, 29464002, 29661169, 30031020, 30100187, 30205376, 30206933, 30279956, 30600477, 30674657, 30684846, 30733337, 30906631, 30967995, 7774910, 9045954, 9563476, 9623977, 9651176, 9766653		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	29464002		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12438307, 17702766, 23404198, 24586395, 30483774, 32593299, 35210406, 35428820, 35764946	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16582100, 17894887, 19360352, 23343716, 23778138, 24337320, 24586395, 26902425, 27453342, 30466785, 30483774, 31592410		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28361860	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29936143		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	17483310		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	17483310		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27871087		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11454718, 12237872, 12237873, 12358350, 14997382, 18056168, 23065687, 23518498, 24200043, 24975429, 25401222, 25600647, 27871936, 28429752, 28498400, 28667340, 28716024, 30906631, 31190865, 31602642, 31692554, 31833327		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	29754146		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24619556		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30365982		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28702328		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32732304, 36231008	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29925919		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	22733545, 29574328		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	22344756	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	27802335		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11393276, 16849574, 17001603, 19541929, 21959981, 27356624, 27721258, 29039472, 30220967		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19541929, 24608861, 27721258, 30936265, 32964019, 33215415, 7534293	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	28146423		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15059898, 18167336, 22798430, 23637916, 28146423, 30967995		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17341621, 17692085		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16721044, 21799864, 23292799, 23990444, 31540229, 32668414, 35833075	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11585734, 12065845, 28193232		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23745020, 27573434, 29344285		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12065845, 17233815, 22537161, 23393547, 25807437, 29596435, 32655498, 37198697, 37929351	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29687852, 31027376		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10454586		★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	31535356		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	17360686		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23284986		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	23284986	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	25942479	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	17011204		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	16766265		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11577016, 15221933, 15993550, 16114066, 17178887, 19010821, 19276347, 19597470, 20585447, 20832018, 21106062, 22349817, 23853093, 24239550, 24406621, 24627085, 24742333, 24780839, 25585568, 25816777, 26314905, 26520443, 26659825, 26891801, 28396462, 30100187		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12646190, 12947120, 17178887		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12947120, 15993550, 18541154, 19010821, 20585447, 21629784, 22349817, 22771493, 24150491, 24627085, 25816777, 26520443, 26659825, 30100187, 33037409, 33323379, 34625422, 39473405	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24742333		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30365982		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29757677	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29166374		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30348808		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17910524		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23744542, 30348808, 30951404		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	28730077		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11381373, 11526499, 11704831, 11896158, 11956106, 12788649, 12870848, 12972807, 13130078, 14681231, 15138575, 15190206, 16081466, 16264179, 16547155, 16601104, 17804740, 17847021, 19636513, 20130960, 20196847, 20220142, 20832018, 20971808, 21045146, 21454377, 22523071, 22782351, 23853093, 26659825, 27237051, 27634906, 27940962, 29202480, 29468551, 30166342, 30191630, 30674657, 31485609, 31666529, 31674056, 8552097, 9187120		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	28361860, 8413230	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30355646	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	21666498		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	15098008	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33564073	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	35621141	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	12358350		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	27903963		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	10454586, 12754218, 9546428		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	12754218, 31142321, 9242506	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22961666, 23792570, 24755270, 26503019, 29115924		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24755270	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22629454, 29713760		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15230729, 16053486, 23280018, 23745020, 25216463, 26475334, 27501502, 30361064		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22344756, 32452220, 36639776, 36768994, 36855110	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	18302964		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	27677255		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10195883, 10862017, 11085515, 22344756, 9748148		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30885939		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26442469, 29526568		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18328430, 19360313, 20510161, 21869593, 24038122, 24810364, 25466554, 25593464, 25646628, 26692098, 26867682, 27683111, 28569791, 29330298, 30006956, 30127643, 31115533		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	17641417		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17641417, 18172256, 18328430		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18328430, 24393368, 25486483, 25646628, 26867682, 30487158, 31115533, 32089626, 33090399, 34564711, 35440106, 36316351	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34938355	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28125090		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	34493366	Associate	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15221933		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	28104681		★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	21983636	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29687852, 35592867	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	32887540	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	12237874	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	21983636		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22389255		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32887540, 36362068	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25788226, 28978043		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30926829, 33824311, 34366326, 35236318, 36720923, 40179432	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20425122, 29358577, 31287003, 32863950, 33261027	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	11896158		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	17012841		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17012841, 23497083, 33723286, 34068980, 34581419, 38537385	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34151839	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	33388092	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP E	Xeroderma Pigmentosum	BEFREE	10373543		★☆☆☆☆ Found in Text Mining only