DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A)

Gene

• Entrez ID: 1859
• Gene name: Dual specificity tyrosine phosphorylation regulated kinase 1A
• Gene symbol: DYRK1A
• Synonyms (NCBI Gene): DYRK, DYRK1, HP86, MNB, MNBH, MRD7
• Chromosome: 21
• Chromosome location: 21q22.13
• Summary: This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs149948846	A>C,G	Conflicting-interpretations-of-pathogenicity	Missense variant, 3 prime UTR variant, coding sequence variant
rs200808105	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, 3 prime UTR variant, coding sequence variant
rs373178770	C>A,G,T	Pathogenic, uncertain-significance	Stop gained, missense variant, coding sequence variant, genic upstream transcript variant
rs376106351	C>A,T	Likely-pathogenic	Synonymous variant, stop gained, coding sequence variant, intron variant
rs587776929	TA>-	Pathogenic	Frameshift variant, genic upstream transcript variant, coding sequence variant
rs587776930	G>A	Pathogenic	Splice donor variant
rs724159951	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs724159953	C>T	Pathogenic	Stop gained, coding sequence variant
rs724159955	C>A	Likely-pathogenic	3 prime UTR variant, missense variant, coding sequence variant
rs724159956	->G	Pathogenic	Frameshift variant, coding sequence variant
rs797044519	C>A,G,T	Pathogenic	Synonymous variant, stop gained, genic upstream transcript variant, coding sequence variant
rs797044520	C>T	Pathogenic	Stop gained, coding sequence variant
rs797044522	AGAT>-	Pathogenic	Frameshift variant, coding sequence variant
rs797045041	G>A	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs797045042	->G	Pathogenic	Frameshift variant, coding sequence variant
rs797045539	->T	Pathogenic	Frameshift variant, coding sequence variant
rs869312708	C>T	Pathogenic, likely-pathogenic	Intron variant, coding sequence variant, stop gained
rs886039652	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs886041658	T>G	Pathogenic	Stop gained, coding sequence variant
rs886041765	GGTAAATGA>-	Pathogenic	Splice donor variant, coding sequence variant, intron variant
rs886041778	ATGACCTT>-	Pathogenic	Frameshift variant, coding sequence variant
rs886041993	CTTG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1057519402	CTTGA>-	Pathogenic	Coding sequence variant, frameshift variant, genic upstream transcript variant
rs1057519628	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064793546	CT>-	Pathogenic	Coding sequence variant, frameshift variant, genic upstream transcript variant
rs1064794006	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064794894	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1064795305	CAATGA>AGAG	Likely-pathogenic	Coding sequence variant, 3 prime UTR variant, frameshift variant
rs1064796316	G>A	Pathogenic	Splice donor variant
rs1064796713	AT>TCTACA	Pathogenic	Coding sequence variant, frameshift variant
rs1064796923	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691661	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1131691909	A>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1555977071	->T	Pathogenic	Frameshift variant, genic upstream transcript variant, coding sequence variant
rs1555977077	C>T	Pathogenic	Stop gained, genic upstream transcript variant, coding sequence variant
rs1555979106	->C	Pathogenic	Frameshift variant, genic upstream transcript variant, coding sequence variant
rs1555979158	->A	Pathogenic	Stop gained, genic upstream transcript variant, coding sequence variant
rs1555985532	C>T	Pathogenic	Stop gained, coding sequence variant
rs1555985554	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1555985620	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1555985642	G>A	Pathogenic	Stop gained, coding sequence variant
rs1555985649	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1555985742	G>T	Pathogenic	Stop gained, coding sequence variant
rs1555990751	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555990816	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1555990855	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1555990955	C>T	Pathogenic	Stop gained, coding sequence variant
rs1555990958	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1555991325	A>G	Likely-pathogenic	Intron variant, splice acceptor variant
rs1555995130	C>A	Likely-pathogenic	Stop gained, 3 prime UTR variant, coding sequence variant
rs1569355102	TAAC>-	Pathogenic	Frameshift variant, genic upstream transcript variant, coding sequence variant
rs1569380375	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1601315812	A>G	Likely-pathogenic	Splice acceptor variant
rs1601316350	->TAAG	Pathogenic	Frameshift variant, coding sequence variant
rs1601319352	CA>-	Pathogenic	Intron variant, frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017031	hsa-miR-335-5p	Microarray	18185580
MIRT024657	hsa-miR-215-5p	Microarray	19074876
MIRT026006	hsa-miR-148a-3p	Sequencing	20371350
MIRT026227	hsa-miR-192-5p	Microarray	19074876
MIRT049774	hsa-miR-92a-3p	CLASH	23622248
MIRT049774	hsa-miR-92a-3p	CLASH	23622248
MIRT044178	hsa-miR-99b-5p	CLASH	23622248
MIRT043199	hsa-miR-324-5p	CLASH	23622248
MIRT053774	hsa-miR-1246	ChIP-seq, Flow, Microarray, qRT-PCR, Western blot	24861464
MIRT642126	hsa-miR-5692a	HITS-CLIP	19536157
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT642126	hsa-miR-5692a	HITS-CLIP	19536157
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT642126	hsa-miR-5692a	HITS-CLIP	19536157
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT642126	hsa-miR-5692a	HITS-CLIP	19536157
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT668638	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT203435	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT668637	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT668636	hsa-miR-5685	HITS-CLIP	23824327
MIRT668635	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT668634	hsa-miR-3135a	HITS-CLIP	23824327
MIRT668633	hsa-miR-1271-3p	HITS-CLIP	23824327
MIRT668632	hsa-miR-550a-3-5p	HITS-CLIP	23824327
MIRT668631	hsa-miR-550a-5p	HITS-CLIP	23824327
MIRT668630	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT668629	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT668628	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT668627	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT668626	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT668625	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT642126	hsa-miR-5692a	HITS-CLIP	23824327
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT085345	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT085346	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT085353	hsa-miR-5680	PAR-CLIP	20371350
MIRT085349	hsa-miR-298	PAR-CLIP	20371350
MIRT507507	hsa-miR-4683	PAR-CLIP	20371350
MIRT507506	hsa-miR-8071	PAR-CLIP	20371350
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT507505	hsa-miR-3165	PAR-CLIP	20371350
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT507504	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT507502	hsa-miR-6844	PAR-CLIP	20371350
MIRT085350	hsa-miR-1270	PAR-CLIP	20371350
MIRT085347	hsa-miR-620	PAR-CLIP	20371350
MIRT085348	hsa-miR-2113	PAR-CLIP	20371350
MIRT085345	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT085346	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT085353	hsa-miR-5680	PAR-CLIP	20371350
MIRT507507	hsa-miR-4683	PAR-CLIP	20371350
MIRT507506	hsa-miR-8071	PAR-CLIP	20371350
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT507505	hsa-miR-3165	PAR-CLIP	20371350
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT507504	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT507502	hsa-miR-6844	PAR-CLIP	20371350
MIRT085350	hsa-miR-1270	PAR-CLIP	20371350
MIRT085347	hsa-miR-620	PAR-CLIP	20371350
MIRT085348	hsa-miR-2113	PAR-CLIP	20371350
MIRT085345	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT085346	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT085353	hsa-miR-5680	PAR-CLIP	20371350
MIRT507507	hsa-miR-4683	PAR-CLIP	20371350
MIRT507506	hsa-miR-8071	PAR-CLIP	20371350
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT507505	hsa-miR-3165	PAR-CLIP	20371350
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT507504	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT507502	hsa-miR-6844	PAR-CLIP	20371350
MIRT085350	hsa-miR-1270	PAR-CLIP	20371350
MIRT085347	hsa-miR-620	PAR-CLIP	20371350
MIRT085348	hsa-miR-2113	PAR-CLIP	20371350
MIRT085345	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT085346	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT085353	hsa-miR-5680	PAR-CLIP	20371350
MIRT507507	hsa-miR-4683	PAR-CLIP	20371350
MIRT507506	hsa-miR-8071	PAR-CLIP	20371350
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT507505	hsa-miR-3165	PAR-CLIP	20371350
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT507504	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT507502	hsa-miR-6844	PAR-CLIP	20371350
MIRT085350	hsa-miR-1270	PAR-CLIP	20371350
MIRT085347	hsa-miR-620	PAR-CLIP	20371350
MIRT085348	hsa-miR-2113	PAR-CLIP	20371350
MIRT085345	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT085346	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT085353	hsa-miR-5680	PAR-CLIP	21572407
MIRT507507	hsa-miR-4683	PAR-CLIP	21572407
MIRT507506	hsa-miR-8071	PAR-CLIP	21572407
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	21572407
MIRT507505	hsa-miR-3165	PAR-CLIP	21572407
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	21572407
MIRT507504	hsa-miR-143-5p	PAR-CLIP	21572407
MIRT507502	hsa-miR-6844	PAR-CLIP	21572407
MIRT085350	hsa-miR-1270	PAR-CLIP	21572407
MIRT085347	hsa-miR-620	PAR-CLIP	21572407
MIRT085348	hsa-miR-2113	PAR-CLIP	21572407
MIRT085345	hsa-miR-224-3p	PAR-CLIP	23446348
MIRT085346	hsa-miR-522-3p	PAR-CLIP	23446348
MIRT085353	hsa-miR-5680	PAR-CLIP	23446348
MIRT507507	hsa-miR-4683	PAR-CLIP	23446348
MIRT507506	hsa-miR-8071	PAR-CLIP	23446348
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT507505	hsa-miR-3165	PAR-CLIP	23446348
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	23446348
MIRT507504	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT507502	hsa-miR-6844	PAR-CLIP	23446348
MIRT085350	hsa-miR-1270	PAR-CLIP	23446348
MIRT085347	hsa-miR-620	PAR-CLIP	23446348
MIRT085348	hsa-miR-2113	PAR-CLIP	23446348
MIRT085345	hsa-miR-224-3p	PAR-CLIP	23446348
MIRT085346	hsa-miR-522-3p	PAR-CLIP	23446348
MIRT085353	hsa-miR-5680	PAR-CLIP	23446348
MIRT507507	hsa-miR-4683	PAR-CLIP	23446348
MIRT507506	hsa-miR-8071	PAR-CLIP	23446348
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT507505	hsa-miR-3165	PAR-CLIP	23446348
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	23446348
MIRT507504	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT507502	hsa-miR-6844	PAR-CLIP	23446348
MIRT085350	hsa-miR-1270	PAR-CLIP	23446348
MIRT085347	hsa-miR-620	PAR-CLIP	23446348
MIRT085348	hsa-miR-2113	PAR-CLIP	23446348
MIRT203408	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT203409	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT734670	hsa-miR-211-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34121317
MIRT642126	hsa-miR-5692a	HITS-CLIP	19536157
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT642126	hsa-miR-5692a	HITS-CLIP	19536157
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT642126	hsa-miR-5692a	HITS-CLIP	19536157
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT668638	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT203435	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT668637	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT668636	hsa-miR-5685	HITS-CLIP	23824327
MIRT668635	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT668634	hsa-miR-3135a	HITS-CLIP	23824327
MIRT668633	hsa-miR-1271-3p	HITS-CLIP	23824327
MIRT668632	hsa-miR-550a-3-5p	HITS-CLIP	23824327
MIRT668631	hsa-miR-550a-5p	HITS-CLIP	23824327
MIRT668630	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT668629	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT668628	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT668627	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT668626	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT668625	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT642126	hsa-miR-5692a	HITS-CLIP	23824327
MIRT351232	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT351238	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT642125	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT642124	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT085345	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT085346	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT085353	hsa-miR-5680	PAR-CLIP	20371350
MIRT085349	hsa-miR-298	PAR-CLIP	20371350
MIRT507507	hsa-miR-4683	PAR-CLIP	20371350
MIRT507506	hsa-miR-8071	PAR-CLIP	20371350
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT507505	hsa-miR-3165	PAR-CLIP	20371350
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT507504	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT507502	hsa-miR-6844	PAR-CLIP	20371350
MIRT085350	hsa-miR-1270	PAR-CLIP	20371350
MIRT085347	hsa-miR-620	PAR-CLIP	20371350
MIRT085348	hsa-miR-2113	PAR-CLIP	20371350
MIRT085345	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT085346	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT085353	hsa-miR-5680	PAR-CLIP	20371350
MIRT507507	hsa-miR-4683	PAR-CLIP	20371350
MIRT507506	hsa-miR-8071	PAR-CLIP	20371350
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT507505	hsa-miR-3165	PAR-CLIP	20371350
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT507504	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT507502	hsa-miR-6844	PAR-CLIP	20371350
MIRT085350	hsa-miR-1270	PAR-CLIP	20371350
MIRT085347	hsa-miR-620	PAR-CLIP	20371350
MIRT085348	hsa-miR-2113	PAR-CLIP	20371350
MIRT085345	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT085346	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT085353	hsa-miR-5680	PAR-CLIP	20371350
MIRT507507	hsa-miR-4683	PAR-CLIP	20371350
MIRT507506	hsa-miR-8071	PAR-CLIP	20371350
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT507505	hsa-miR-3165	PAR-CLIP	20371350
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT507504	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT507502	hsa-miR-6844	PAR-CLIP	20371350
MIRT085350	hsa-miR-1270	PAR-CLIP	20371350
MIRT085347	hsa-miR-620	PAR-CLIP	20371350
MIRT085348	hsa-miR-2113	PAR-CLIP	20371350
MIRT085345	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT085346	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT085353	hsa-miR-5680	PAR-CLIP	20371350
MIRT507507	hsa-miR-4683	PAR-CLIP	20371350
MIRT507506	hsa-miR-8071	PAR-CLIP	20371350
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT507505	hsa-miR-3165	PAR-CLIP	20371350
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT507504	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT507502	hsa-miR-6844	PAR-CLIP	20371350
MIRT085350	hsa-miR-1270	PAR-CLIP	20371350
MIRT085347	hsa-miR-620	PAR-CLIP	20371350
MIRT085348	hsa-miR-2113	PAR-CLIP	20371350
MIRT085345	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT085346	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT085353	hsa-miR-5680	PAR-CLIP	21572407
MIRT507507	hsa-miR-4683	PAR-CLIP	21572407
MIRT507506	hsa-miR-8071	PAR-CLIP	21572407
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	21572407
MIRT507505	hsa-miR-3165	PAR-CLIP	21572407
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	21572407
MIRT507504	hsa-miR-143-5p	PAR-CLIP	21572407
MIRT507502	hsa-miR-6844	PAR-CLIP	21572407
MIRT085350	hsa-miR-1270	PAR-CLIP	21572407
MIRT085347	hsa-miR-620	PAR-CLIP	21572407
MIRT085348	hsa-miR-2113	PAR-CLIP	21572407
MIRT085345	hsa-miR-224-3p	PAR-CLIP	23446348
MIRT085346	hsa-miR-522-3p	PAR-CLIP	23446348
MIRT085353	hsa-miR-5680	PAR-CLIP	23446348
MIRT507507	hsa-miR-4683	PAR-CLIP	23446348
MIRT507506	hsa-miR-8071	PAR-CLIP	23446348
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT507505	hsa-miR-3165	PAR-CLIP	23446348
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	23446348
MIRT507504	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT507502	hsa-miR-6844	PAR-CLIP	23446348
MIRT085350	hsa-miR-1270	PAR-CLIP	23446348
MIRT085347	hsa-miR-620	PAR-CLIP	23446348
MIRT085348	hsa-miR-2113	PAR-CLIP	23446348
MIRT085345	hsa-miR-224-3p	PAR-CLIP	23446348
MIRT085346	hsa-miR-522-3p	PAR-CLIP	23446348
MIRT085353	hsa-miR-5680	PAR-CLIP	23446348
MIRT507507	hsa-miR-4683	PAR-CLIP	23446348
MIRT507506	hsa-miR-8071	PAR-CLIP	23446348
MIRT085355	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT507505	hsa-miR-3165	PAR-CLIP	23446348
MIRT507503	hsa-miR-3944-5p	PAR-CLIP	23446348
MIRT507504	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT507502	hsa-miR-6844	PAR-CLIP	23446348
MIRT085350	hsa-miR-1270	PAR-CLIP	23446348
MIRT085347	hsa-miR-620	PAR-CLIP	23446348
MIRT085348	hsa-miR-2113	PAR-CLIP	23446348
MIRT949531	hsa-let-7a	CLIP-seq
MIRT949532	hsa-let-7b	CLIP-seq
MIRT949533	hsa-let-7c	CLIP-seq
MIRT949534	hsa-let-7d	CLIP-seq
MIRT949535	hsa-let-7e	CLIP-seq
MIRT949536	hsa-let-7f	CLIP-seq
MIRT949537	hsa-let-7g	CLIP-seq
MIRT949538	hsa-let-7i	CLIP-seq
MIRT949539	hsa-miR-101	CLIP-seq
MIRT949540	hsa-miR-106a	CLIP-seq
MIRT949541	hsa-miR-106b	CLIP-seq
MIRT949542	hsa-miR-1236	CLIP-seq
MIRT949543	hsa-miR-1263	CLIP-seq
MIRT949544	hsa-miR-1278	CLIP-seq
MIRT949545	hsa-miR-1294	CLIP-seq
MIRT949546	hsa-miR-1297	CLIP-seq
MIRT949547	hsa-miR-1305	CLIP-seq
MIRT949548	hsa-miR-144	CLIP-seq
MIRT949549	hsa-miR-154	CLIP-seq
MIRT949550	hsa-miR-17	CLIP-seq
MIRT949551	hsa-miR-1827	CLIP-seq
MIRT949552	hsa-miR-194	CLIP-seq
MIRT949553	hsa-miR-197	CLIP-seq
MIRT949554	hsa-miR-199a-3p	CLIP-seq
MIRT949555	hsa-miR-199b-3p	CLIP-seq
MIRT949556	hsa-miR-204	CLIP-seq
MIRT949557	hsa-miR-20a	CLIP-seq
MIRT949558	hsa-miR-20b	CLIP-seq
MIRT949559	hsa-miR-211	CLIP-seq
MIRT949560	hsa-miR-217	CLIP-seq
MIRT949561	hsa-miR-221	CLIP-seq
MIRT949562	hsa-miR-222	CLIP-seq
MIRT949563	hsa-miR-2467-3p	CLIP-seq
MIRT949564	hsa-miR-26a	CLIP-seq
MIRT949565	hsa-miR-26b	CLIP-seq
MIRT949566	hsa-miR-27a	CLIP-seq
MIRT949567	hsa-miR-27b	CLIP-seq
MIRT949568	hsa-miR-28-3p	CLIP-seq
MIRT949569	hsa-miR-302f	CLIP-seq
MIRT949570	hsa-miR-3129-5p	CLIP-seq
MIRT949571	hsa-miR-3135b	CLIP-seq
MIRT949572	hsa-miR-3152-3p	CLIP-seq
MIRT949573	hsa-miR-3157-3p	CLIP-seq
MIRT949574	hsa-miR-3163	CLIP-seq
MIRT949575	hsa-miR-3190	CLIP-seq
MIRT949576	hsa-miR-3200-3p	CLIP-seq
MIRT949577	hsa-miR-320e	CLIP-seq
MIRT949578	hsa-miR-323-3p	CLIP-seq
MIRT949579	hsa-miR-330-3p	CLIP-seq
MIRT949580	hsa-miR-3609	CLIP-seq
MIRT949581	hsa-miR-3613-3p	CLIP-seq
MIRT949582	hsa-miR-3687	CLIP-seq
MIRT949583	hsa-miR-3689d	CLIP-seq
MIRT949584	hsa-miR-3690	CLIP-seq
MIRT949585	hsa-miR-380	CLIP-seq
MIRT949586	hsa-miR-3927	CLIP-seq
MIRT949587	hsa-miR-3942-3p	CLIP-seq
MIRT949588	hsa-miR-3973	CLIP-seq
MIRT949589	hsa-miR-409-5p	CLIP-seq
MIRT949590	hsa-miR-412	CLIP-seq
MIRT949591	hsa-miR-425	CLIP-seq
MIRT949592	hsa-miR-4254	CLIP-seq
MIRT949593	hsa-miR-4257	CLIP-seq
MIRT949594	hsa-miR-4268	CLIP-seq
MIRT949595	hsa-miR-4274	CLIP-seq
MIRT949596	hsa-miR-4282	CLIP-seq
MIRT949597	hsa-miR-4290	CLIP-seq
MIRT949598	hsa-miR-4307	CLIP-seq
MIRT949599	hsa-miR-4316	CLIP-seq
MIRT949600	hsa-miR-4321	CLIP-seq
MIRT949601	hsa-miR-4418	CLIP-seq
MIRT949602	hsa-miR-4426	CLIP-seq
MIRT949603	hsa-miR-4442	CLIP-seq
MIRT949604	hsa-miR-4448	CLIP-seq
MIRT949605	hsa-miR-4458	CLIP-seq
MIRT949606	hsa-miR-4460	CLIP-seq
MIRT949607	hsa-miR-4465	CLIP-seq
MIRT949608	hsa-miR-4494	CLIP-seq
MIRT949609	hsa-miR-4500	CLIP-seq
MIRT949610	hsa-miR-4520a-3p	CLIP-seq
MIRT949611	hsa-miR-4539	CLIP-seq
MIRT949612	hsa-miR-4638-3p	CLIP-seq
MIRT949613	hsa-miR-4647	CLIP-seq
MIRT949614	hsa-miR-4661-3p	CLIP-seq
MIRT949615	hsa-miR-4662b	CLIP-seq
MIRT949616	hsa-miR-4663	CLIP-seq
MIRT949617	hsa-miR-4678	CLIP-seq
MIRT949618	hsa-miR-4694-5p	CLIP-seq
MIRT949619	hsa-miR-4699-5p	CLIP-seq
MIRT949620	hsa-miR-4704-3p	CLIP-seq
MIRT949621	hsa-miR-4719	CLIP-seq
MIRT949622	hsa-miR-4727-3p	CLIP-seq
MIRT949623	hsa-miR-4733-5p	CLIP-seq
MIRT949624	hsa-miR-4752	CLIP-seq
MIRT949625	hsa-miR-4797-3p	CLIP-seq
MIRT949626	hsa-miR-4803	CLIP-seq
MIRT949627	hsa-miR-485-3p	CLIP-seq
MIRT949628	hsa-miR-498	CLIP-seq
MIRT949629	hsa-miR-509-3-5p	CLIP-seq
MIRT949630	hsa-miR-509-5p	CLIP-seq
MIRT949631	hsa-miR-513a-5p	CLIP-seq
MIRT949632	hsa-miR-519a	CLIP-seq
MIRT949633	hsa-miR-519b-3p	CLIP-seq
MIRT949634	hsa-miR-519c-3p	CLIP-seq
MIRT949635	hsa-miR-519d	CLIP-seq
MIRT949636	hsa-miR-520g	CLIP-seq
MIRT949637	hsa-miR-520h	CLIP-seq
MIRT949638	hsa-miR-544	CLIP-seq
MIRT949639	hsa-miR-548ac	CLIP-seq
MIRT949640	hsa-miR-548ae	CLIP-seq
MIRT949641	hsa-miR-548ah	CLIP-seq
MIRT949642	hsa-miR-548aj	CLIP-seq
MIRT949643	hsa-miR-548am	CLIP-seq
MIRT949644	hsa-miR-548c-3p	CLIP-seq
MIRT949645	hsa-miR-548d-3p	CLIP-seq
MIRT949646	hsa-miR-548v	CLIP-seq
MIRT949647	hsa-miR-548x	CLIP-seq
MIRT949648	hsa-miR-548z	CLIP-seq
MIRT949649	hsa-miR-581	CLIP-seq
MIRT949650	hsa-miR-582-5p	CLIP-seq
MIRT949651	hsa-miR-587	CLIP-seq
MIRT949652	hsa-miR-592	CLIP-seq
MIRT949653	hsa-miR-597	CLIP-seq
MIRT949654	hsa-miR-599	CLIP-seq
MIRT949655	hsa-miR-600	CLIP-seq
MIRT949656	hsa-miR-640	CLIP-seq
MIRT949657	hsa-miR-642a	CLIP-seq
MIRT949658	hsa-miR-642b	CLIP-seq
MIRT949659	hsa-miR-643	CLIP-seq
MIRT949660	hsa-miR-645	CLIP-seq
MIRT949661	hsa-miR-671-5p	CLIP-seq
MIRT949662	hsa-miR-874	CLIP-seq
MIRT949663	hsa-miR-892a	CLIP-seq
MIRT949664	hsa-miR-9	CLIP-seq
MIRT949665	hsa-miR-93	CLIP-seq
MIRT949666	hsa-miR-936	CLIP-seq
MIRT949667	hsa-miR-98	CLIP-seq
MIRT949560	hsa-miR-217	CLIP-seq
MIRT949574	hsa-miR-3163	CLIP-seq
MIRT1981318	hsa-miR-3169	CLIP-seq
MIRT949581	hsa-miR-3613-3p	CLIP-seq
MIRT1981319	hsa-miR-3617	CLIP-seq
MIRT949584	hsa-miR-3690	CLIP-seq
MIRT949598	hsa-miR-4307	CLIP-seq
MIRT1981320	hsa-miR-4672	CLIP-seq
MIRT949620	hsa-miR-4704-3p	CLIP-seq
MIRT1981321	hsa-miR-513a-3p	CLIP-seq
MIRT949639	hsa-miR-548ac	CLIP-seq
MIRT949645	hsa-miR-548d-3p	CLIP-seq
MIRT949648	hsa-miR-548z	CLIP-seq
MIRT949651	hsa-miR-587	CLIP-seq
MIRT1981322	hsa-miR-641	CLIP-seq
MIRT1981323	hsa-miR-124	CLIP-seq
MIRT949549	hsa-miR-154	CLIP-seq
MIRT949553	hsa-miR-197	CLIP-seq
MIRT949556	hsa-miR-204	CLIP-seq
MIRT949559	hsa-miR-211	CLIP-seq
MIRT1981324	hsa-miR-216a	CLIP-seq
MIRT1981325	hsa-miR-216b	CLIP-seq
MIRT1981326	hsa-miR-3065-5p	CLIP-seq
MIRT949572	hsa-miR-3152-3p	CLIP-seq
MIRT949578	hsa-miR-323-3p	CLIP-seq
MIRT949580	hsa-miR-3609	CLIP-seq
MIRT949581	hsa-miR-3613-3p	CLIP-seq
MIRT1981327	hsa-miR-3714	CLIP-seq
MIRT1981328	hsa-miR-3910	CLIP-seq
MIRT949590	hsa-miR-412	CLIP-seq
MIRT1981329	hsa-miR-421	CLIP-seq
MIRT1981330	hsa-miR-4272	CLIP-seq
MIRT1981331	hsa-miR-4452	CLIP-seq
MIRT949608	hsa-miR-4494	CLIP-seq
MIRT1981332	hsa-miR-4635	CLIP-seq
MIRT1981333	hsa-miR-4709-5p	CLIP-seq
MIRT949627	hsa-miR-485-3p	CLIP-seq
MIRT1981334	hsa-miR-506	CLIP-seq
MIRT949636	hsa-miR-520g	CLIP-seq
MIRT949637	hsa-miR-520h	CLIP-seq
MIRT949641	hsa-miR-548ah	CLIP-seq
MIRT949658	hsa-miR-642b	CLIP-seq
MIRT1981335	hsa-miR-873	CLIP-seq
MIRT1981336	hsa-miR-885-3p	CLIP-seq
MIRT949663	hsa-miR-892a	CLIP-seq
MIRT949539	hsa-miR-101	CLIP-seq
MIRT949540	hsa-miR-106a	CLIP-seq
MIRT949541	hsa-miR-106b	CLIP-seq
MIRT2216341	hsa-miR-1208	CLIP-seq
MIRT2216342	hsa-miR-1229	CLIP-seq
MIRT2216343	hsa-miR-1258	CLIP-seq
MIRT949544	hsa-miR-1278	CLIP-seq
MIRT949545	hsa-miR-1294	CLIP-seq
MIRT949548	hsa-miR-144	CLIP-seq
MIRT2216344	hsa-miR-148a	CLIP-seq
MIRT2216345	hsa-miR-148b	CLIP-seq
MIRT2216346	hsa-miR-152	CLIP-seq
MIRT949549	hsa-miR-154	CLIP-seq
MIRT949550	hsa-miR-17	CLIP-seq
MIRT949551	hsa-miR-1827	CLIP-seq
MIRT2216347	hsa-miR-1973	CLIP-seq
MIRT2216348	hsa-miR-2053	CLIP-seq
MIRT949557	hsa-miR-20a	CLIP-seq
MIRT949558	hsa-miR-20b	CLIP-seq
MIRT1981324	hsa-miR-216a	CLIP-seq
MIRT1981325	hsa-miR-216b	CLIP-seq
MIRT949560	hsa-miR-217	CLIP-seq
MIRT949561	hsa-miR-221	CLIP-seq
MIRT949562	hsa-miR-222	CLIP-seq
MIRT949566	hsa-miR-27a	CLIP-seq
MIRT949567	hsa-miR-27b	CLIP-seq
MIRT2216349	hsa-miR-3120-5p	CLIP-seq
MIRT949572	hsa-miR-3152-3p	CLIP-seq
MIRT949574	hsa-miR-3163	CLIP-seq
MIRT1981318	hsa-miR-3169	CLIP-seq
MIRT949576	hsa-miR-3200-3p	CLIP-seq
MIRT949578	hsa-miR-323-3p	CLIP-seq
MIRT2216350	hsa-miR-346	CLIP-seq
MIRT2216351	hsa-miR-3607-3p	CLIP-seq
MIRT949580	hsa-miR-3609	CLIP-seq
MIRT949581	hsa-miR-3613-3p	CLIP-seq
MIRT2216352	hsa-miR-3614-3p	CLIP-seq
MIRT1981319	hsa-miR-3617	CLIP-seq
MIRT2216353	hsa-miR-3688-5p	CLIP-seq
MIRT949584	hsa-miR-3690	CLIP-seq
MIRT2216354	hsa-miR-3926	CLIP-seq
MIRT949588	hsa-miR-3973	CLIP-seq
MIRT2216355	hsa-miR-3977	CLIP-seq
MIRT949591	hsa-miR-425	CLIP-seq
MIRT2216356	hsa-miR-4255	CLIP-seq
MIRT2216357	hsa-miR-4264	CLIP-seq
MIRT2216358	hsa-miR-4266	CLIP-seq
MIRT1981330	hsa-miR-4272	CLIP-seq
MIRT949595	hsa-miR-4274	CLIP-seq
MIRT2216359	hsa-miR-4276	CLIP-seq
MIRT2216360	hsa-miR-4279	CLIP-seq
MIRT949596	hsa-miR-4282	CLIP-seq
MIRT2216361	hsa-miR-4288	CLIP-seq
MIRT2216362	hsa-miR-4302	CLIP-seq
MIRT2216363	hsa-miR-4310	CLIP-seq
MIRT949599	hsa-miR-4316	CLIP-seq
MIRT949600	hsa-miR-4321	CLIP-seq
MIRT2216364	hsa-miR-4325	CLIP-seq
MIRT949601	hsa-miR-4418	CLIP-seq
MIRT2216365	hsa-miR-4444	CLIP-seq
MIRT949606	hsa-miR-4460	CLIP-seq
MIRT949608	hsa-miR-4494	CLIP-seq
MIRT2216366	hsa-miR-452	CLIP-seq
MIRT949611	hsa-miR-4539	CLIP-seq
MIRT1981320	hsa-miR-4672	CLIP-seq
MIRT2216367	hsa-miR-4676-3p	CLIP-seq
MIRT949617	hsa-miR-4678	CLIP-seq
MIRT949620	hsa-miR-4704-3p	CLIP-seq
MIRT2216368	hsa-miR-4718	CLIP-seq
MIRT949622	hsa-miR-4727-3p	CLIP-seq
MIRT949623	hsa-miR-4733-5p	CLIP-seq
MIRT2216369	hsa-miR-4735-5p	CLIP-seq
MIRT2216370	hsa-miR-4753-5p	CLIP-seq
MIRT2216371	hsa-miR-4772-3p	CLIP-seq
MIRT2216372	hsa-miR-4786-5p	CLIP-seq
MIRT949625	hsa-miR-4797-3p	CLIP-seq
MIRT2216373	hsa-miR-486-5p	CLIP-seq
MIRT949628	hsa-miR-498	CLIP-seq
MIRT949629	hsa-miR-509-3-5p	CLIP-seq
MIRT949630	hsa-miR-509-5p	CLIP-seq
MIRT949631	hsa-miR-513a-5p	CLIP-seq
MIRT949632	hsa-miR-519a	CLIP-seq
MIRT949633	hsa-miR-519b-3p	CLIP-seq
MIRT949634	hsa-miR-519c-3p	CLIP-seq
MIRT949635	hsa-miR-519d	CLIP-seq
MIRT949636	hsa-miR-520g	CLIP-seq
MIRT949637	hsa-miR-520h	CLIP-seq
MIRT949638	hsa-miR-544	CLIP-seq
MIRT949639	hsa-miR-548ac	CLIP-seq
MIRT949640	hsa-miR-548ae	CLIP-seq
MIRT949641	hsa-miR-548ah	CLIP-seq
MIRT949642	hsa-miR-548aj	CLIP-seq
MIRT949643	hsa-miR-548am	CLIP-seq
MIRT949644	hsa-miR-548c-3p	CLIP-seq
MIRT949645	hsa-miR-548d-3p	CLIP-seq
MIRT949646	hsa-miR-548v	CLIP-seq
MIRT949647	hsa-miR-548x	CLIP-seq
MIRT949648	hsa-miR-548z	CLIP-seq
MIRT2216374	hsa-miR-569	CLIP-seq
MIRT949649	hsa-miR-581	CLIP-seq
MIRT949650	hsa-miR-582-5p	CLIP-seq
MIRT949651	hsa-miR-587	CLIP-seq
MIRT949652	hsa-miR-592	CLIP-seq
MIRT949653	hsa-miR-597	CLIP-seq
MIRT949654	hsa-miR-599	CLIP-seq
MIRT949655	hsa-miR-600	CLIP-seq
MIRT2216375	hsa-miR-628-5p	CLIP-seq
MIRT2216376	hsa-miR-632	CLIP-seq
MIRT2216377	hsa-miR-634	CLIP-seq
MIRT1981322	hsa-miR-641	CLIP-seq
MIRT949658	hsa-miR-642b	CLIP-seq
MIRT949663	hsa-miR-892a	CLIP-seq
MIRT949665	hsa-miR-93	CLIP-seq
MIRT949578	hsa-miR-323-3p	CLIP-seq
MIRT2216360	hsa-miR-4279	CLIP-seq
MIRT949655	hsa-miR-600	CLIP-seq
MIRT949545	hsa-miR-1294	CLIP-seq
MIRT949551	hsa-miR-1827	CLIP-seq
MIRT949566	hsa-miR-27a	CLIP-seq
MIRT949567	hsa-miR-27b	CLIP-seq
MIRT949574	hsa-miR-3163	CLIP-seq
MIRT949581	hsa-miR-3613-3p	CLIP-seq
MIRT949595	hsa-miR-4274	CLIP-seq
MIRT949596	hsa-miR-4282	CLIP-seq
MIRT949599	hsa-miR-4316	CLIP-seq
MIRT949620	hsa-miR-4704-3p	CLIP-seq
MIRT949631	hsa-miR-513a-5p	CLIP-seq
MIRT949639	hsa-miR-548ac	CLIP-seq
MIRT949640	hsa-miR-548ae	CLIP-seq
MIRT949642	hsa-miR-548aj	CLIP-seq
MIRT949643	hsa-miR-548am	CLIP-seq
MIRT949645	hsa-miR-548d-3p	CLIP-seq
MIRT949647	hsa-miR-548x	CLIP-seq
MIRT949648	hsa-miR-548z	CLIP-seq
MIRT949540	hsa-miR-106a	CLIP-seq
MIRT949541	hsa-miR-106b	CLIP-seq
MIRT2520337	hsa-miR-1290	CLIP-seq
MIRT949548	hsa-miR-144	CLIP-seq
MIRT949550	hsa-miR-17	CLIP-seq
MIRT949552	hsa-miR-194	CLIP-seq
MIRT949557	hsa-miR-20a	CLIP-seq
MIRT949558	hsa-miR-20b	CLIP-seq
MIRT2520338	hsa-miR-3167	CLIP-seq
MIRT949588	hsa-miR-3973	CLIP-seq
MIRT949626	hsa-miR-4803	CLIP-seq
MIRT949632	hsa-miR-519a	CLIP-seq
MIRT949633	hsa-miR-519b-3p	CLIP-seq
MIRT949634	hsa-miR-519c-3p	CLIP-seq
MIRT949635	hsa-miR-519d	CLIP-seq
MIRT949636	hsa-miR-520g	CLIP-seq
MIRT949637	hsa-miR-520h	CLIP-seq
MIRT2520339	hsa-miR-522	CLIP-seq
MIRT2520340	hsa-miR-548a-3p	CLIP-seq
MIRT949639	hsa-miR-548ac	CLIP-seq
MIRT949640	hsa-miR-548ae	CLIP-seq
MIRT949642	hsa-miR-548aj	CLIP-seq
MIRT949643	hsa-miR-548am	CLIP-seq
MIRT949644	hsa-miR-548c-3p	CLIP-seq
MIRT949645	hsa-miR-548d-3p	CLIP-seq
MIRT2520341	hsa-miR-548e	CLIP-seq
MIRT2520342	hsa-miR-548f	CLIP-seq
MIRT949647	hsa-miR-548x	CLIP-seq
MIRT949648	hsa-miR-548z	CLIP-seq
MIRT949649	hsa-miR-581	CLIP-seq
MIRT949652	hsa-miR-592	CLIP-seq
MIRT949653	hsa-miR-597	CLIP-seq
MIRT949654	hsa-miR-599	CLIP-seq
MIRT2520343	hsa-miR-601	CLIP-seq
MIRT2520344	hsa-miR-876-5p	CLIP-seq
MIRT949665	hsa-miR-93	CLIP-seq
MIRT2520337	hsa-miR-1290	CLIP-seq
MIRT949548	hsa-miR-144	CLIP-seq
MIRT949552	hsa-miR-194	CLIP-seq
MIRT2679616	hsa-miR-3145-3p	CLIP-seq
MIRT2520338	hsa-miR-3167	CLIP-seq
MIRT2679617	hsa-miR-3671	CLIP-seq
MIRT2679618	hsa-miR-371-5p	CLIP-seq
MIRT2679619	hsa-miR-371b-5p	CLIP-seq
MIRT2679620	hsa-miR-3941	CLIP-seq
MIRT1981331	hsa-miR-4452	CLIP-seq
MIRT2679621	hsa-miR-4643	CLIP-seq
MIRT2679622	hsa-miR-466	CLIP-seq
MIRT1981320	hsa-miR-4672	CLIP-seq
MIRT2679623	hsa-miR-4680-3p	CLIP-seq
MIRT2679624	hsa-miR-4724-5p	CLIP-seq
MIRT2679625	hsa-miR-4789-3p	CLIP-seq
MIRT949626	hsa-miR-4803	CLIP-seq
MIRT949639	hsa-miR-548ac	CLIP-seq
MIRT949640	hsa-miR-548ae	CLIP-seq
MIRT949642	hsa-miR-548aj	CLIP-seq
MIRT949643	hsa-miR-548am	CLIP-seq
MIRT949645	hsa-miR-548d-3p	CLIP-seq
MIRT949647	hsa-miR-548x	CLIP-seq
MIRT949648	hsa-miR-548z	CLIP-seq
MIRT2679626	hsa-miR-606	CLIP-seq
MIRT2520344	hsa-miR-876-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
REST	Unknown	21252229

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	ISS
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	22492721
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003779	Function	Actin binding	IPI	24327345
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8769099, 8975710
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IGI	17906291
GO:0004674	Function	Protein serine/threonine kinase activity	ISS	20736167
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	28386764
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	8769099
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	9748265
GO:0005515	Function	Protein binding	IPI	14500717, 14593110, 15694837, 17229891, 20736167, 20940704, 23602568, 24327345, 26949739, 27173435, 27705803, 30561431, 32296183, 32707033, 33961781, 35016035, 35271311, 35914814, 36950384
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	25620562
GO:0005634	Component	Nucleus	IDA	15694837, 23415227
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15694837
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	24327345
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IDA	24327345
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IPI	24327345
GO:0005883	Component	Neurofilament	IPI	24327345
GO:0005884	Component	Actin filament	IPI	24327345
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IDA	23333306
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006468	Process	Protein phosphorylation	ISS
GO:0007399	Process	Nervous system development	TAS	8769099
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0008092	Function	Cytoskeletal protein binding	IPI	24327345
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IDA	25620562, 29849146
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IEA
GO:0015631	Function	Tubulin binding	IPI	24327345
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0016607	Component	Nuclear speck	ISS
GO:0016607	Component	Nuclear speck	TAS	28377597
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	9748265
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	ISS
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031115	Process	Negative regulation of microtubule polymerization	IEA
GO:0031115	Process	Negative regulation of microtubule polymerization	ISS	17906291
GO:0031452	Process	Negative regulation of heterochromatin formation	IDA	24820035
GO:0033120	Process	Positive regulation of RNA splicing	IBA
GO:0033120	Process	Positive regulation of RNA splicing	IDA	28377597
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	23665168
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	ISS	20736167
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0046777	Process	Protein autophosphorylation	ISS
GO:0048025	Process	Negative regulation of mRNA splicing, via spliceosome	IEA
GO:0048156	Function	Tau protein binding	IEA
GO:0048156	Function	Tau protein binding	IPI	25556849
GO:0048156	Function	Tau protein binding	ISS	17906291, 20736167
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0106310	Function	Protein serine kinase activity	IDA	25556849, 30773093
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140857	Function	Histone H3T45 kinase activity	IDA	24820035
GO:1902003	Process	Regulation of amyloid-beta formation	IMP	25556849
GO:1902996	Process	Regulation of neurofibrillary tangle assembly	IDA	25556849
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:1990935	Function	Splicing factor binding	ISS

Other IDs

• MIM: 600855
• HGNC: 3091
• e!Ensembl: ENSG00000157540

Protein

• UniProt ID: Q13627
• Protein name: Dual specificity tyrosine-phosphorylation-regulated kinase 1A (EC 2.7.11.23) (EC 2.7.12.1) (Dual specificity YAK1-related kinase) (HP86) (Protein kinase minibrain homolog) (MNBH) (hMNB)
• Protein function: Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities (PubMed:20981014, PubMed:21127067, PubMed:23665168, PubMed:30773093, PubMed:8769099). Exhibits a substrate preference for proline at position P+1 and ar
• PDB: 2VX3, 2WO6, 3ANQ, 3ANR, 4AZE, 4MQ1, 4MQ2, 4NCT, 4YLJ, 4YLK, 4YLL, 4YU2, 5A3X, 5A4E, 5A4L, 5A4Q, 5A4T, 5A54, 5AIK, 6A1F, 6A1G, 6EIF, 6EIJ, 6EIL, 6EIP, 6EIQ, 6EIR, 6EIS, 6EIV, 6EJ4, 6LN1, 6QU2, 6S11, 6S14, 6S17, 6S1B, 6S1H, 6S1I, 6S1J, 6T6A, 6UIP, 6UWY, 6YF8, 7A4O, 7A4R, 7A4S, 7A4W, 7A4Z, 7A51, 7A52, 7A53
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	159 → 479	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highest levels in skeletal muscle, testis, fetal lung and fetal kidney. {ECO:0000269|PubMed:10329007, ECO:0000269|PubMed:8769099, ECO:0000269|PubMed:8872470, ECO:0000269|PubMed:8975710}.
• Sequence:

  MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSD
  QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
  QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
  EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
  LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
  SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
  FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
  RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
  KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
  HFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
  HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
  STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
  QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS

• Sequence length: 763

Pathways

Reactome:

G0 and Early G1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Absent or delayed speech development	Pathogenic	rs724159949, rs724159950	RCV000149559 RCV000149560	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autism spectrum disorder	Pathogenic	rs724159948	RCV003126545	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Complex neurodevelopmental disorder	Pathogenic; Likely pathogenic	rs724159953, rs797044521, rs797045041, rs746177928, rs1057518204, rs1064796367, rs780441716, rs1064794006, rs376106351, rs1131691946, rs1555984461, rs1555990958, rs1555990946, rs1555984102, rs1555985642, rs1555979106, rs2052604858, rs2052610181	RCV001265301 RCV001265238 RCV001265307 RCV001265300 RCV001265465 RCV001265303 RCV001265464 RCV001265463 RCV001265302 RCV001265308 RCV001265140 RCV001265304 RCV001265306 RCV001265239 RCV001265305 RCV001265241 RCV001265138 RCV001265240	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Deeply set eye	Pathogenic	rs724159949, rs724159950	RCV000149559 RCV000149560	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DYRK1A-related disorder	Pathogenic; Likely pathogenic	rs797044520, rs753795563, rs1601315812	RCV001731507 RCV004536425 RCV004540122	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DYRK1A-related intellectual disability syndrome	Pathogenic; Likely pathogenic	rs1555984343, rs2148619406, rs1555980223, rs1555984237, rs2148613196, rs1555984245, rs2148627802, rs2148582438, rs2148612925, rs2148601107, rs2148619635, rs2148612254, rs2148612226, rs2148612918, rs2148619382, rs1555994573, rs2148571670, rs2148571757, rs2148627691, rs2148612654, rs2148571400, rs2518028469, rs2148571595, rs2148612955, rs1555980296, rs2518048199, rs2518027869, rs2518073567, rs724159949, rs724159948, rs724159953, rs2518037803, rs2518073518, rs2518074058, rs1555979164, rs745768777, rs797044519, rs797044523, rs797044521, rs797044524, rs797044525, rs797044526, rs797044522, rs797044520, rs2518073750, rs797045042, rs797045041, rs2518074711, rs2518077369, rs755806405, rs2052604858, rs797045540, rs797045539, rs2518010515, rs753795563, rs2518009959, rs2518096175, rs2517958091, rs2518048441, rs869312708, rs1555994836, rs2518048062, rs2518097031, rs746177928, rs886041291, rs886041658, rs2518010357, rs2518077085, rs2518028401, rs2518048258, rs2518037603, rs2517988225, rs1064796939, rs2518097345, rs2518037791, rs2518010459, rs1555982699, rs2518027620, rs2517958077, rs2053260627, rs2518048064, rs2518027659, rs2518048433, rs2518028565, rs1057516030, rs1057518204, rs1057519402, rs1057519628, rs1039571136, rs1064793546, rs1064796367, rs780441716, rs1064794894, rs1131691866, rs1555984461, rs1555990958, rs1555985554, rs373178770, rs1555985532, rs1555979158, rs1555984064, rs587776929, rs587776930, rs1555982601, rs1555985649, rs1555984102, rs1555984433, rs1569370887, rs1569371303, rs1569376809, rs1569355102, rs1555980234, rs1555990955, rs1569380375, rs1555980467, rs1555985742, rs1601319086, rs1601267617, rs1601315812, rs1601319352, rs1049773, rs2052872878, rs2053564046, rs2053566582, rs202011970, rs1555977171, rs2052612564, rs1555985524, rs2053566124, rs2053150009, rs2517974544, rs2518073461, rs2053036372, rs2052613493, rs1555987107, rs1064796406	RCV001314065 RCV001375544 RCV001390863 RCV001380327 RCV004017843 RCV001507330 RCV002032642 RCV001729976 RCV001733879 RCV001775231 RCV001775397 RCV001808073 RCV001843785 RCV001869860 RCV001966294 RCV001886651 RCV001953826 RCV001903249 RCV001957513 RCV001883099 RCV001987193 RCV002249923 RCV002251253 RCV002463582 RCV004594629 RCV002255087 RCV002287858 RCV002289115 RCV002290279 RCV002290311 RCV000190478 RCV000503841 RCV000193013 RCV002302431 RCV004594643 RCV002468701 RCV002470368 RCV002601874 RCV000190477 RCV000190482 RCV000190480 RCV000190483 RCV000190484 RCV000190485 RCV000190481 RCV000190479 RCV002810940 RCV000191082 RCV000191081 RCV002842306 RCV002862062 RCV002863685 RCV002858116 RCV000192601 RCV000194800 RCV002880374 RCV002894388 RCV002994060 RCV002994230 RCV003022871 RCV003051914 RCV003027820 RCV000209829 RCV003128307 RCV003223502 RCV003223517 RCV003225713 RCV003640883 RCV003126661 RCV002519054 RCV003313009 RCV003322724 RCV003326183 RCV003441169 RCV003885338 RCV003494077 RCV003528606 RCV003528484 RCV003528908 RCV003641668 RCV003641720 RCV003641831 RCV003983797 RCV003985142 RCV003986046 RCV004566397 RCV004557274 RCV004594946 RCV000408621 RCV000499667 RCV000417097 RCV000417095 RCV000496117 RCV000032825 RCV001251101 RCV000698811 RCV002526592 RCV003528179 RCV000501673 RCV000500665 RCV000503079 RCV000505215 RCV002250650 RCV002289712 RCV003640906 RCV000543161 RCV000576181 RCV000032822 RCV000032823 RCV001867985 RCV000601140 RCV001376170 RCV000677426 RCV000700316 RCV000692267 RCV001175155 RCV000735221 RCV000760218 RCV001254070 RCV000770999 RCV000811825 RCV000823165 RCV000795332 RCV000824848 RCV000824986 RCV000995762 RCV001061288 RCV001171513 RCV001198032 RCV001197239 RCV001238745 RCV001252225 RCV001253225 RCV001253651 RCV001253550 RCV001253787 RCV001255846 RCV001255759 RCV001255832 RCV001264823 RCV003120519 RCV001380647 RCV001294451	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Feeding difficulties	Pathogenic	rs724159949, rs724159950	RCV000149559 RCV000149560	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Generalized-onset seizure	Pathogenic	rs724159949	RCV001003637	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Pathogenic	rs2148574292, rs724159949, rs886041291	RCV001526589 RCV001003637 RCV001255396	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Pathogenic; Likely pathogenic	rs2148619520, rs2148613196, rs2148582538, rs2148662758, rs2148649530, rs2148619667, rs2148613074, rs1555984429, rs2148612918, rs724159949, rs724159950, rs724159948, rs724159956, rs797045041, rs1057518474, rs1057518204, rs1064793546, rs1064796406, rs1555984064, rs1555990805, rs2052604910, rs2053040180, rs2053265002	RCV001507301 RCV001507302 RCV001507303 RCV001507304 RCV001507305 RCV001507326 RCV001507327 RCV001509580 RCV001843833 RCV000149559 RCV000149560 RCV001507325 RCV001260675 RCV001260679 RCV001507309 RCV005625581 RCV001509579 RCV001507306 RCV001260680 RCV001251045 RCV001260676 RCV001260698 RCV001260697	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Male infertility with spermatogenesis disorder	Likely pathogenic	rs2517987908, rs200519444	RCV003991637 RCV003991638	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Pathogenic	rs724159949, rs724159950	RCV000149559 RCV000149560	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microphthalmia	Pathogenic	rs724159949	RCV001003637	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLECYSTITIS, ACUTE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUAL SPECIFICITY TYROSINE PHOSPHORYLATION REGULATED KINASE 1A-RELATED INTELLECTUAL DISABILITY SYNDROME DUE TO 21Q22.13Q22.2 MICRODELETION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYRK1A-RELATED INTELLECTUAL DISABILITY SYNDROME DUE TO 21Q22.13Q22.2 MICRODELETION	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYRK1A-RELATED INTELLECTUAL DISABILITY SYNDROME DUE TO A POINT MUTATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED SEIZURES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, AUTOSOMAL DOMINANT 7	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability syndrome due to a DYRK1A point mutation	Uncertain significance	ClinVar Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROPHTHALMOS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUDDEN INFANT DEATH SYNDROME	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	22354166, 22354171		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	27601662		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18696092, 19995442, 20067632, 21573099, 25264830, 25756379, 26234946, 31683476, 32957634, 33380426, 33633844, 35194165	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27807027	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	17135279		★☆☆☆☆ Found in Text Mining only
Amblyopia	Amblyopia	Pubtator	33562844	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	20456003, 25116835		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	25756379	Associate	★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	23099646, 25944381		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman syndrome	Pubtator	25944381	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30343272, 31838052		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	23077488	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28377597		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28377597		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	25944381	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23160955, 25707398, 32553196, 32887689, 32918531, 33562844, 33998396, 37031308, 37802655, 38382213	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autism Spectrum Disorder	Autism	Pubtator	32193494	Stimulate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23160955, 25707398, 28167836, 28735747, 29223763		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	25167861, 25707398, 25920557, 29034068, 32918531	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25707398, 25920557, 28167836, 29700199, 30831192		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Primary Microcephaly	Primary microcephaly	Pubtator	25920557	Associate	★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	29942082		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31347059		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	31263215		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22751441	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35244188	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31454149		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30383316		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	27601662		★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	11555628, 15068245, 17145134, 18940310, 21135538, 23173067, 24152332, 28377597, 28766366, 28779511, 30115750, 30332747		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	30496304	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29773344		★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Craniofacial Abnormalities	Craniofacial abnormalities	Pubtator	30496304	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous syndactyly of toes	Syndactyly Of The Toes	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	21156028, 22269890, 29661714, 29698690, 31683476		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	31683476	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	18696092, 23077488, 25707398, 25944381, 28053047, 31024071, 33813175, 37802655	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	28053047, 31024071		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30095246, 30170319		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30095246, 30170319, 31306739		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30979931, 32957634	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30059217, 31293498		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10329007, 11555628, 12192061, 12814361, 15068245, 15198122, 15917294, 16242644, 16455265, 16554754, 16919501, 16924111, 17145134, 17237124, 17906291, 18005339, 18231969, 18405873, 18696092, 18771760, 18940310, 19192387, 19383720, 19597142, 19685005, 19801542, 20101688, 20167603, 20456003, 20558441, 20600907, 20696760, 21135538, 21156027, 21156028, 21157379, 21637297, 21965663, 22354166, 22354171, 22389395, 22669612, 22751441, 22767602, 22827956, 23099646, 23147510, 23173067, 23512985, 23830204, 24152332, 24334122, 24801365, 24806449, 25490145, 25591821, 25641759, 25707398, 25920557, 26137553, 26373433, 26803494, 27056896, 27743462, 28137862, 28250274, 28264138, 28377597, 28478033, 28540658, 28647555, 28735747, 28766366, 28775333, 28874550, 28944229, 29039762, 29127398, 29221819, 29342922, 29364148, 29434250, 29495936, 29850989, 29985601, 30115750, 30170319, 30227164, 30243157, 30268771, 30332747, 30389461, 30496304, 30649339, 30703437, 30745319, 30831192, 30979931, 31024071, 31201803, 31605772, 31683476, 31766108, 31803016, 8769099, 8975710, 9048932		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	12964950, 16959772, 17237124, 18366763, 18405873, 18696092, 19016842, 19597142, 21573099, 21637297, 22751441, 24119401, 24820035, 25264830, 25707398, 25920557, 25944381, 27245352, 27807027, 28250274, 28884684, 30496304, 30979931, 31024071, 31201803, 31683476, 32957634, 33380426, 33562844, 33633844, 34127780, 35194165, 37451904, 37792788, 37802655	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	15068245, 15694837, 16919501, 18005339, 18509201, 18696092		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23830204	Stimulate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28425089		★☆☆☆☆ Found in Text Mining only
DYRK1A-related intellectual disability syndrome due to 21q22.13q22.2 microdeletion	Mental retardation	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	12192061, 12814361, 17237124, 18364031, 18405873, 19383720, 19685005, 21204217, 21294719, 2143053, 22918246, 23099646, 23512985, 25167861, 25707398, 25920557, 25944381, 26922654		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	23637414		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	23637414	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	18405873, 33813175, 38382213	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	23099646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	CTD_human_DG	29942082		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	29942082		★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	28053047, 33813175	Associate	★☆☆☆☆ Found in Text Mining only
Eye Abnormalities	Eye abnormalities	Pubtator	25944381	Associate	★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	29034068	Associate	★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	29223763		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	23635774, 30401502		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33924599, 34309232, 37387444	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23635774, 30401502		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23635774		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34309232	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	12192061, 25641759, 25707398, 26922654		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Developmental Delay	CLINVAR_DG	25944381		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gross motor development delay	Developmental delay	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	25944381	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	32341405	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	30998504		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	30172984		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31723029		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	Pubtator	25944381	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	25920557	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	37792788	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35244188	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	11555628, 15068245, 17145134, 18940310, 21135538, 23173067, 24152332, 24801365, 28377597, 28766366, 28779511, 29985601, 30115750, 30332747		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	11555628, 17145134, 19801542, 20456003, 21135538, 21156028, 23077488, 23099646, 23124096, 23147510, 25641759, 25920557, 26803494, 26922654, 28779511, 31263215, 31803247, 9048932		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	16959772, 23077488, 25707398, 25920557, 25944381, 29034068, 30137413, 30496304, 31683476, 33562844, 33813175, 38382213	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual disability syndrome due to a DYRK1A point mutation	Mental retardation	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Language Development Disorders	Language development disorders	Pubtator	25920557, 29034068, 33813175	Associate	★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	30496304, 32341405	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	31640433	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24901999	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37216686	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24901999		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	16959772	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	22269890		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	37792788	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31454149, 32587776	Associate	★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	23160955		★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macular degeneration	Macular Degeneration	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25795597		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31347059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31454149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31838052		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19458618, 22751441, 25591821, 25795597, 28766366, 29985601, 30401502, 31454149		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19671150		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22669612		★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	23173067, 29700199		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	11555628, 17145134, 19801542, 20456003, 21135538, 21156028, 23077488, 23124096, 28779511, 31803247, 9048932		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Retardation	Mental retardation	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Retardation Autosomal Recessive 7	Intellectual developmental disorder	Pubtator	33562844	Associate	★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 7	Mental retardation	GENOMICS_ENGLAND_DG	23099646, 25944381		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 7	Mental retardation	CLINVAR_DG	23160955, 25167861, 25533962, 25641759, 25707398, 25920557, 25944381, 26633545, 26922654, 27241786, 28053047, 29034068		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 7	Mental retardation	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	10329007, 18405873, 20358607, 23099646, 23160955, 24922073, 25920557, 25944381, 26922654, 29223763, 29495936, 30137413, 31803247		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Microcephaly	LHGDN	18405873		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Microcephaly	Pubtator	18405873, 23160955, 25707398, 25920557, 25944381, 28884684, 29034068, 30137413, 33562844, 33813175, 38382213	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Microcephaly	GENOMICS_ENGLAND_DG	25944381		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Microcephaly	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moderate expressive language delay	Expressive Language Delay	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	12192061, 12814361, 17237124, 18364031, 18405873, 19383720, 19685005, 21204217, 21294719, 2143053, 22918246, 23099646, 23512985, 25167861, 25707398, 25920557, 25944381, 26922654		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31217840		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22354166, 24901999, 27601662, 27796319, 30343272, 31024071		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28264138, 30059217, 30170319		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33860868	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25264830	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16242644, 21156028, 23173067, 30172984, 30268771, 31766108		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	16242644		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental disorder	Pubtator	25707398	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	26194112, 29223763		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	28191889, 29942082		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTICISM	Neuroticism	BEFREE	18957941		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31454149		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	27601662		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopenia	Osteopenia	BEFREE	19801542		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32629664, 33755733	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31838052		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30343272, 31838052		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22269890, 24922073, 27085534, 27546826, 29698690, 30904670, 31572127		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	34617105	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Partial Trisomy	Trisomy	BEFREE	11555628, 18231969, 20600907, 22669612		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	16242644		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	21156028, 22269890, 29661714, 29698690, 31683476		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37792788	Associate	★☆☆☆☆ Found in Text Mining only
Receptive language delay	Receptive language delay	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30503061		★☆☆☆☆ Found in Text Mining only
Secondary microcephaly	Microcephaly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	25920557, 25944381	Associate	★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	18405873, 25707398	Associate	★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Severe receptive language delay	Delayed speech and language development	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Simple syndactyly of toes, first web space	Syndactyly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Speech Delay	Speech Delay	BEFREE	29223763		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27796319, 28650432		★☆☆☆☆ Found in Text Mining only
Stereotypical hand wringing	Stereotypy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	Pubtator	33562844	Associate	★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	16242644		★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Thyroid Dysgenesis	BEFREE	25490145		★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	29034068, 33562844	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	27601662		★☆☆☆☆ Found in Text Mining only