DUSP9 (dual specificity phosphatase 9)

Gene

• Entrez ID: 1852
• Gene name: Dual specificity phosphatase 9
• Gene symbol: DUSP9
• Synonyms (NCBI Gene): MKP-4, MKP4
• Chromosome: X
• Chromosome location: Xq28
• Summary: The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027506	hsa-miR-98-5p	Microarray	19088304
MIRT494020	hsa-miR-1321	PAR-CLIP	23592263
MIRT494021	hsa-miR-4739	PAR-CLIP	23592263
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT494018	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT494017	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT494016	hsa-miR-4270	PAR-CLIP	23592263
MIRT494015	hsa-miR-4441	PAR-CLIP	23592263
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT494013	hsa-miR-7706	PAR-CLIP	23592263
MIRT494012	hsa-miR-7515	PAR-CLIP	23592263
MIRT494011	hsa-miR-3179	PAR-CLIP	23592263
MIRT494009	hsa-miR-3197	PAR-CLIP	23592263
MIRT494010	hsa-miR-4271	PAR-CLIP	23592263
MIRT494008	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT494007	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT494006	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT494005	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT494020	hsa-miR-1321	PAR-CLIP	27292025
MIRT494020	hsa-miR-1321	PAR-CLIP	27292025
MIRT494016	hsa-miR-4270	PAR-CLIP	27292025
MIRT494016	hsa-miR-4270	PAR-CLIP	27292025
MIRT494015	hsa-miR-4441	PAR-CLIP	27292025
MIRT494015	hsa-miR-4441	PAR-CLIP	27292025
MIRT494021	hsa-miR-4739	PAR-CLIP	27292025
MIRT494021	hsa-miR-4739	PAR-CLIP	27292025
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT494020	hsa-miR-1321	PAR-CLIP	23592263
MIRT494021	hsa-miR-4739	PAR-CLIP	23592263
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT494018	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT494017	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT494016	hsa-miR-4270	PAR-CLIP	23592263
MIRT494015	hsa-miR-4441	PAR-CLIP	23592263
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT494013	hsa-miR-7706	PAR-CLIP	23592263
MIRT494012	hsa-miR-7515	PAR-CLIP	23592263
MIRT494011	hsa-miR-3179	PAR-CLIP	23592263
MIRT494009	hsa-miR-3197	PAR-CLIP	23592263
MIRT494010	hsa-miR-4271	PAR-CLIP	23592263
MIRT494008	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT494007	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT494006	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT494005	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT948390	hsa-miR-1252	CLIP-seq
MIRT948391	hsa-miR-186	CLIP-seq
MIRT948392	hsa-miR-3133	CLIP-seq
MIRT948393	hsa-miR-4504	CLIP-seq
MIRT948394	hsa-miR-452	CLIP-seq
MIRT948395	hsa-miR-4676-3p	CLIP-seq
MIRT948396	hsa-miR-4731-3p	CLIP-seq
MIRT948397	hsa-miR-4801	CLIP-seq
MIRT948398	hsa-miR-549	CLIP-seq
MIRT1548079	hsa-miR-3921	CLIP-seq
MIRT1548080	hsa-miR-4251	CLIP-seq
MIRT1548081	hsa-miR-4279	CLIP-seq
MIRT1548082	hsa-miR-4329	CLIP-seq
MIRT1548083	hsa-miR-4653-5p	CLIP-seq
MIRT1548084	hsa-miR-4786-5p	CLIP-seq
MIRT1548085	hsa-miR-769-5p	CLIP-seq
MIRT1981003	hsa-miR-1184	CLIP-seq
MIRT1981004	hsa-miR-1301	CLIP-seq
MIRT1981005	hsa-miR-3127-3p	CLIP-seq
MIRT1981006	hsa-miR-3138	CLIP-seq
MIRT1981007	hsa-miR-328	CLIP-seq
MIRT1981008	hsa-miR-3911	CLIP-seq
MIRT1981009	hsa-miR-4258	CLIP-seq
MIRT1981010	hsa-miR-4453	CLIP-seq
MIRT1981011	hsa-miR-4520a-3p	CLIP-seq
MIRT1981012	hsa-miR-4538	CLIP-seq
MIRT1981013	hsa-miR-4660	CLIP-seq
MIRT1981014	hsa-miR-4800-5p	CLIP-seq
MIRT1981015	hsa-miR-5047	CLIP-seq
MIRT2216133	hsa-miR-615-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	TAS	9030581
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	11988087, 21908610, 27880917, 31980649, 32707033, 33961781
GO:0005634	Component	Nucleus	TAS	9030581
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9030581
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006470	Process	Protein dephosphorylation	TAS	9030581
GO:0007165	Process	Signal transduction	IBA
GO:0007254	Process	JNK cascade	TAS	9030581
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IEA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	TAS
GO:0008330	Function	Protein tyrosine/threonine phosphatase activity	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA
GO:0033550	Function	MAP kinase tyrosine phosphatase activity	IBA
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	TAS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA

Other IDs

• MIM: 300134
• HGNC: 3076
• e!Ensembl: ENSG00000130829

Protein

• UniProt ID: Q99956
• Protein name: Dual specificity protein phosphatase 9 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen-activated protein kinase phosphatase 4) (MAP kinase phosphatase 4) (MKP-4)
• Protein function: Inactivates MAP kinases. Has a specificity for the ERK family.
• PDB: 2HXP, 3LJ8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00581	Rhodanese	7 → 133	Rhodanese-like domain	Domain
  PF00782	DSPc	211 → 343	Dual specificity phosphatase, catalytic domain	Domain

• Sequence:

  MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
  VRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLA
  YYLQGGFSRFQAECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADR
  DSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNL
  PNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTV
  TVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQA
  SAASNPPSFFTTPTSDGAFELAPT

• Sequence length: 384

Pathways

KEGG:

MAPK signaling pathway
Signaling pathways regulating pluripotency of stem cells

Reactome:

RAF-independent MAPK1/3 activation
Negative regulation of MAPK pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	29880481		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21253009, 21943117	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24838152		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24838152, 28483913	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21253009, 21943117		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20581827		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31772940	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20581827		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20581827, 22961080, 23029454	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21350842, 21643948, 22961080, 23029454, 23448427		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	23276385		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30063256		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30063256		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31772940		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31772940	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30923463		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29880481		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25998184		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14767517, 30923463		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35999349	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23146750, 28919193		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21943117, 24838152, 30923463		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30063256		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23146750		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36980809	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21943117		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25998184		★☆☆☆☆ Found in Text Mining only