Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1841
Gene name	Deoxythymidylate kinase
Gene symbol	DTYMK
Synonyms (NCBI Gene)	CDC8CONPMPP3731TMPKTYMK
Chromosome	2
Chromosome location	2q37.3

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025515	hsa-miR-34a-5p	Proteomics	21566225
MIRT025515	hsa-miR-34a-5p	Proteomics	21566225
MIRT025515	hsa-miR-34a-5p	Proteomics	21566225
MIRT025515	hsa-miR-34a-5p	Proteomics	21566225
MIRT025947	hsa-miR-7-5p	Microarray	19073608
MIRT047109	hsa-miR-183-5p	CLASH	23622248
MIRT947258	hsa-miR-1231	CLIP-seq
MIRT947259	hsa-miR-1276	CLIP-seq
MIRT947260	hsa-miR-1299	CLIP-seq
MIRT947261	hsa-miR-3140-5p	CLIP-seq
MIRT947262	hsa-miR-3153	CLIP-seq
MIRT947263	hsa-miR-3617	CLIP-seq
MIRT947264	hsa-miR-382	CLIP-seq
MIRT947265	hsa-miR-3923	CLIP-seq
MIRT947266	hsa-miR-4266	CLIP-seq
MIRT947267	hsa-miR-4670-3p	CLIP-seq
MIRT947268	hsa-miR-641	CLIP-seq
MIRT947269	hsa-miR-651	CLIP-seq
MIRT947270	hsa-miR-7	CLIP-seq
MIRT947271	hsa-miR-875-3p	CLIP-seq
MIRT1980572	hsa-miR-1224-3p	CLIP-seq
MIRT1980573	hsa-miR-1260	CLIP-seq
MIRT1980574	hsa-miR-1260b	CLIP-seq
MIRT1980575	hsa-miR-1280	CLIP-seq
MIRT1980576	hsa-miR-150	CLIP-seq
MIRT1980577	hsa-miR-4297	CLIP-seq
MIRT1980578	hsa-miR-4652-5p	CLIP-seq
MIRT1980579	hsa-miR-4713-5p	CLIP-seq
MIRT1980580	hsa-miR-4787-5p	CLIP-seq
MIRT1980581	hsa-miR-532-3p	CLIP-seq
MIRT1980582	hsa-miR-937	CLIP-seq
MIRT2215566	hsa-miR-3175	CLIP-seq
MIRT2215567	hsa-miR-4436a	CLIP-seq
MIRT2215568	hsa-miR-4797-5p	CLIP-seq
MIRT2215569	hsa-miR-759	CLIP-seq
MIRT2519975	hsa-miR-148a	CLIP-seq
MIRT2519976	hsa-miR-148b	CLIP-seq
MIRT2519977	hsa-miR-152	CLIP-seq
MIRT2519978	hsa-miR-1825	CLIP-seq
MIRT2519979	hsa-miR-1827	CLIP-seq
MIRT2519980	hsa-miR-2355-5p	CLIP-seq
MIRT2519981	hsa-miR-298	CLIP-seq
MIRT2519982	hsa-miR-3158-5p	CLIP-seq
MIRT2519983	hsa-miR-34c-3p	CLIP-seq
MIRT2519984	hsa-miR-4267	CLIP-seq
MIRT2519985	hsa-miR-4286	CLIP-seq
MIRT2519986	hsa-miR-4420	CLIP-seq
MIRT2519987	hsa-miR-4480	CLIP-seq
MIRT2519988	hsa-miR-4539	CLIP-seq
MIRT2519989	hsa-miR-4724-5p	CLIP-seq
MIRT2519990	hsa-miR-4738-3p	CLIP-seq
MIRT1980580	hsa-miR-4787-5p	CLIP-seq
MIRT2519991	hsa-miR-486-3p	CLIP-seq
MIRT2519992	hsa-miR-596	CLIP-seq
MIRT2519993	hsa-miR-615-5p	CLIP-seq
MIRT2215569	hsa-miR-759	CLIP-seq
MIRT2519994	hsa-miR-767-3p	CLIP-seq
MIRT2519975	hsa-miR-148a	CLIP-seq
MIRT2519976	hsa-miR-148b	CLIP-seq
MIRT2519977	hsa-miR-152	CLIP-seq
MIRT2519978	hsa-miR-1825	CLIP-seq
MIRT2519979	hsa-miR-1827	CLIP-seq
MIRT2519980	hsa-miR-2355-5p	CLIP-seq
MIRT2519981	hsa-miR-298	CLIP-seq
MIRT2519982	hsa-miR-3158-5p	CLIP-seq
MIRT2519984	hsa-miR-4267	CLIP-seq
MIRT2519985	hsa-miR-4286	CLIP-seq
MIRT2519987	hsa-miR-4480	CLIP-seq
MIRT1980580	hsa-miR-4787-5p	CLIP-seq
MIRT2519991	hsa-miR-486-3p	CLIP-seq
MIRT2519992	hsa-miR-596	CLIP-seq
MIRT2519993	hsa-miR-615-5p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IBA
GO:0004798	Function	DTMP kinase activity	IBA
GO:0004798	Function	DTMP kinase activity	IDA	8845311, 12614151
GO:0004798	Function	DTMP kinase activity	IEA
GO:0004798	Function	DTMP kinase activity	TAS	8024690
GO:0005524	Function	ATP binding	IDA	12614151
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006227	Process	DUDP biosynthetic process	IBA
GO:0006233	Process	DTDP biosynthetic process	IBA
GO:0006233	Process	DTDP biosynthetic process	IDA	12614151
GO:0006233	Process	DTDP biosynthetic process	IEA
GO:0006233	Process	DTDP biosynthetic process	IEA
GO:0006235	Process	DTTP biosynthetic process	IBA
GO:0006235	Process	DTTP biosynthetic process	IEA
GO:0009165	Process	Nucleotide biosynthetic process	IEA
GO:0009165	Process	Nucleotide biosynthetic process	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046105	Process	Thymidine biosynthetic process	IDA	12614151
GO:0046105	Process	Thymidine biosynthetic process	TAS	8024690
GO:0071363	Process	Cellular response to growth factor stimulus	IEA

MIM	HGNC	e!Ensembl
188345	3061	ENSG00000168393

P23919

Protein name

Thymidylate kinase (EC 2.7.4.9) (dTMP kinase)

Protein function

Catalyzes the phosphorylation of thymidine monophosphate (dTMP) to thymidine diphosphate (dTDP), the immediate precursor for the DNA building block dTTP, with ATP as the preferred phosphoryl donor in the presence of Mg(2+). {ECO:0000269|PubMed:1

PDB

1E2D , 1E2E , 1E2F , 1E2G , 1E2Q , 1E98 , 1E99 , 1E9A , 1E9B , 1E9C , 1E9D , 1E9E , 1E9F , 1NMX , 1NMY , 1NMZ , 1NN0 , 1NN1 , 1NN3 , 1NN5 , 2XX3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02223	Thymidylate_kin	11 → 191	Thymidylate kinase	Domain

Sequence

MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKK
SDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQP
DVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDA
SKSIEAVHEDIRVLSEDAIRTATEKPLGELWK

Sequence length

212

Interactions

View interactions

	KEGG		Reactome
	Pyrimidine metabolism Metabolic pathways Nucleotide metabolism		Interconversion of nucleotide di- and triphosphates

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodegeneration, childhood-onset, with progressive microcephaly	Pathogenic	rs1005167119, rs887888951, rs373875797, rs1267106442	RCV002248378 RCV002248379 RCV002248380 RCV002248381	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEPLETION OF MITOCHONDRIAL DEOXYRIBONUCLEIC ACID	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DNA DEPLETION SYNDROME	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	34369850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34049287, 34369850, 37400785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36170019	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23715154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35603384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18413751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18413751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18413751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	12918113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32638267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23715154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24194950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23928772, 24194950, 26072401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18413751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36320118	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	34994281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23715154, 23928772, 24194950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8024690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34994281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11160865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24194950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24194950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DTYMK (deoxythymidylate kinase)