DTX1 (deltex E3 ubiquitin ligase 1)

Gene

• Entrez ID: 1840
• Gene name: Deltex E3 ubiquitin ligase 1
• Gene symbol: DTX1
• Synonyms (NCBI Gene): RNF140, hDx-1
• Chromosome: 12
• Chromosome location: 12q24.13
• Summary: Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity. [pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017334	hsa-miR-335-5p	Microarray	18185580
MIRT023569	hsa-miR-1-3p	Microarray	18668037
MIRT711752	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT711751	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT711750	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT711749	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT711748	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT711747	hsa-miR-6895-3p	HITS-CLIP	19536157
MIRT711746	hsa-miR-593-3p	HITS-CLIP	19536157
MIRT711745	hsa-miR-6830-3p	HITS-CLIP	19536157
MIRT711744	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT711743	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT711742	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT711741	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT711740	hsa-miR-6818-3p	HITS-CLIP	19536157
MIRT711739	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT711738	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT711737	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT711752	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT711751	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT711750	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT711749	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT711748	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT711747	hsa-miR-6895-3p	HITS-CLIP	19536157
MIRT711746	hsa-miR-593-3p	HITS-CLIP	19536157
MIRT711745	hsa-miR-6830-3p	HITS-CLIP	19536157
MIRT711744	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT711743	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT711742	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT711741	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT711740	hsa-miR-6818-3p	HITS-CLIP	19536157
MIRT711739	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT711738	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT711737	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT946954	hsa-miR-1254	CLIP-seq
MIRT946955	hsa-miR-1270	CLIP-seq
MIRT946956	hsa-miR-1273f	CLIP-seq
MIRT946957	hsa-miR-185	CLIP-seq
MIRT946958	hsa-miR-2392	CLIP-seq
MIRT946959	hsa-miR-3116	CLIP-seq
MIRT946960	hsa-miR-3165	CLIP-seq
MIRT946961	hsa-miR-3166	CLIP-seq
MIRT946962	hsa-miR-3202	CLIP-seq
MIRT946963	hsa-miR-3605-5p	CLIP-seq
MIRT946964	hsa-miR-3678-3p	CLIP-seq
MIRT946965	hsa-miR-4254	CLIP-seq
MIRT946966	hsa-miR-4306	CLIP-seq
MIRT946967	hsa-miR-4434	CLIP-seq
MIRT946968	hsa-miR-4516	CLIP-seq
MIRT946969	hsa-miR-4644	CLIP-seq
MIRT946970	hsa-miR-4683	CLIP-seq
MIRT946971	hsa-miR-4718	CLIP-seq
MIRT946972	hsa-miR-4747-5p	CLIP-seq
MIRT946973	hsa-miR-4771	CLIP-seq
MIRT946974	hsa-miR-620	CLIP-seq
MIRT1980434	hsa-miR-2115	CLIP-seq
MIRT946961	hsa-miR-3166	CLIP-seq
MIRT946964	hsa-miR-3678-3p	CLIP-seq
MIRT1980435	hsa-miR-4488	CLIP-seq
MIRT1980436	hsa-miR-4667-5p	CLIP-seq
MIRT1980437	hsa-miR-4697-5p	CLIP-seq
MIRT1980438	hsa-miR-4700-5p	CLIP-seq
MIRT946971	hsa-miR-4718	CLIP-seq
MIRT946973	hsa-miR-4771	CLIP-seq
MIRT1980439	hsa-miR-637	CLIP-seq
MIRT2215492	hsa-miR-1302	CLIP-seq
MIRT2215493	hsa-miR-1324	CLIP-seq
MIRT2215494	hsa-miR-3126-3p	CLIP-seq
MIRT946961	hsa-miR-3166	CLIP-seq
MIRT2215495	hsa-miR-3192	CLIP-seq
MIRT946964	hsa-miR-3678-3p	CLIP-seq
MIRT2215496	hsa-miR-4298	CLIP-seq
MIRT2215497	hsa-miR-4314	CLIP-seq
MIRT2215498	hsa-miR-4493	CLIP-seq
MIRT2215499	hsa-miR-4646-5p	CLIP-seq
MIRT946971	hsa-miR-4718	CLIP-seq
MIRT946973	hsa-miR-4771	CLIP-seq
MIRT946961	hsa-miR-3166	CLIP-seq
MIRT946964	hsa-miR-3678-3p	CLIP-seq
MIRT946971	hsa-miR-4718	CLIP-seq
MIRT946973	hsa-miR-4771	CLIP-seq
MIRT2448573	hsa-miR-1262	CLIP-seq
MIRT2448574	hsa-miR-1293	CLIP-seq
MIRT946961	hsa-miR-3166	CLIP-seq
MIRT2448575	hsa-miR-4483	CLIP-seq
MIRT2448576	hsa-miR-4701-3p	CLIP-seq
MIRT2448573	hsa-miR-1262	CLIP-seq
MIRT2448574	hsa-miR-1293	CLIP-seq
MIRT946961	hsa-miR-3166	CLIP-seq
MIRT2448575	hsa-miR-4483	CLIP-seq
MIRT2448576	hsa-miR-4701-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	TAS	9590294
GO:0005112	Function	Notch binding	IDA	11564735
GO:0005515	Function	Protein binding	IPI	7671825, 17028573, 21124883, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9590294
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	NAS	11564735
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9590294
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9590294
GO:0007219	Process	Notch signaling pathway	IBA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008593	Process	Regulation of Notch signaling pathway	IGI	11564735
GO:0010001	Process	Glial cell differentiation	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	17028573
GO:0045581	Process	Negative regulation of T cell differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IGI	11564735
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

Other IDs

• MIM: 602582
• HGNC: 3060
• e!Ensembl: ENSG00000135144

Protein

• UniProt ID: Q86Y01
• Protein name: E3 ubiquitin-protein ligase DTX1 (EC 2.3.2.27) (Protein deltex-1) (Deltex1) (hDTX1) (RING-type E3 ubiquitin transferase DTX1)
• Protein function: Functions as a ubiquitin ligase protein in vivo, mediating ubiquitination and promoting degradation of MEKK1, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity (By similarity). Regulator of Notch signaling, a s
• PDB: 6Y5N, 6Y5P, 8R5N, 8R6A, 8R6B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02825	WWE	26 → 94	WWE domain	Family
  PF02825	WWE	107 → 171	WWE domain	Family
  PF00097	zf-C3HC4	411 → 471	Zinc finger, C3HC4 type (RING finger)	Domain
  PF18102	DTC	479 → 613	Deltex C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Strongly expressed in blood vessel. Also expressed in embryonic nervous system, pancreas, lung, adrenal gland, digestive tube and muscles. Expressed in MZB cells and developing B- and T-cells. {ECO:0000269|PubMed:1275
• Sequence:

  MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
  VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTA
  YDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLT
  VGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPPAPPLPPPPPPGG
  PPGALAVRPSATFTGAALWAAPAAGPAEPAPPPGAPPRSPGAPGGARTPGQNNLNRPGPQ
  RTTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPILHP
  PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVT
  ASGYEGVLRHKGVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEKTG
  TQPPGKMEFHLIPHSLPGFPDTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPN
  NEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASY
  LDNVLAELTAQGVSEAAAKA

• Sequence length: 620

Pathways

KEGG:

Notch signaling pathway

Reactome:

Activated NOTCH1 Transmits Signal to the Nucleus

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, PANCREATIC DUCTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Oligodendroglioma	Oligodendroglioma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30629240		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31313037		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	CTD_human_DG	19208345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood Oligodendroglioma	Oligodendroglioma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28931525		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36160034	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23451269, 26662803		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23451269, 26662803	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23451269, 26662803		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	35937947	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18768695		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30629240		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	30802265	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31313037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29374180		★☆☆☆☆ Found in Text Mining only
Mixed Oligodendroglioma-Astrocytoma	Mixed Oligodendroglioma-Astrocytoma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only
Mixed Oligodendroglioma-Ependymoma	Mixed Oligodendroglioma-Ependymoma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28146432		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31313037		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	11153911		★☆☆☆☆ Found in Text Mining only
Oligodendroblastoma	Oligodendroblastoma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	CTD_human_DG	21127729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	20208568		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20208568	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	27557513	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17646409		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	39661563	Inhibit	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32700476	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28146432	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28146432		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29374180		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29374180	Inhibit	★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	BEFREE	16103065		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	39661563	Inhibit	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	39661563	Inhibit	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only